DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and NMNAT1

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001284707.1 Gene:NMNAT1 HGNCID:17877 Length:279 Species:Homo sapiens

Alignment Length:257 Identity:116/258 (45%)
Similarity:160/258 (62%) Gaps:21/258 (8%)


  Fly    46 IAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKKGLASALDRCAMVKLA 110
            :..:|||.|:|.|.||||:||:|||:....|.:.||.|||||..|:|.||||..|..|..|.:||
Human     9 VVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELA 73

  Fly   111 TQSSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSGGGGGDDGENT---HLPG----WL-- 166
            |::|.|:.:..||..|.:|..|..||:|||..:.      ....|..:|:   ..||    |.  
Human    74 TKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLE------ASDCDHQQNSPTLERPGRKRKWTET 132

  Fly   167 -----PRGLHDSRDPV-HLKLLCGADLLESFAVPGLWAEADIEDIVANHGLVVITRAGSNPGKFI 225
                 .:.|......| .:|||||||||||||||.||...||..||||:||:.:||||::..|||
Human   133 QDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFI 197

  Fly   226 FDSDILTKYQSNITLITNWVPNEVSSTLIRRLLGRGQSVKYLLDDLVLEYIKRQRLFNFKSK 287
            ::||:|.|::|||.::..|:.|::|||.|||.|.||||::||:.|||.|||::..|::.:|:
Human   198 YESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESE 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 115/251 (46%)
NMNAT1NP_001284707.1 NMNAT_Eukarya 9..254 CDD:185681 115/251 (46%)
Substrate binding. {ECO:0000269|PubMed:11959140} 55..57 1/2 (50%)
Substrate binding. {ECO:0000269|PubMed:11788603, ECO:0000269|PubMed:11959140} 92..95 1/3 (33%)
Nuclear localization signal. {ECO:0000255} 123..129 2/6 (33%)
Substrate binding. {ECO:0000269|PubMed:11788603, ECO:0000269|PubMed:11959140} 168..169 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C18042258
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3523
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1308027at2759
OrthoFinder 1 1.000 FOG0001264
OrthoInspector 1 1.000 T609642
orthoMCL 1 0.900 OOG5_128044
Panther 1 1.100 O PTHR12039
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R815
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.