DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and nmnat3

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_700826.3 Gene:nmnat3 ZFINID:ZDB-GENE-070912-331 Length:249 Species:Danio rerio

Alignment Length:248 Identity:104/249 (42%)
Similarity:147/249 (59%) Gaps:29/249 (12%)


  Fly    46 IAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKKGLASALDRCAMVKLA 110
            :..:|||.|:|.|..|:|:||:|:||....|.:|||||||||..|.|||:||.::..|.||.:||
Zfish     7 LVLLACGSFNPITHQHMRLFELARDHMHQTGLYRVVGGIISPVGDGYGKQGLVASKHRLAMARLA 71

  Fly   111 TQSSNWIRLSDWEVHQNQWMRTQAVLQHH------QNYINNHINSGGGGGDDGENTHLPGWLPRG 169
            .|||:|:.:.|||..|..|..|...:::|      |:..|                       :|
Zfish    72 LQSSDWVSVDDWESQQPDWTETVVTMRYHYGRVAAQHCCN-----------------------KG 113

  Fly   170 LHDSRDPVHLKLLCGADLLESFAVPGLWAEADIEDIVANHGLVVITRAGSNPGKFIFDSDILTKY 234
            ...:.|...||||||||.::||.|||||.:..||::|...|||.::|....|.:.|.:||:|:|:
Zfish   114 PPTTSDVPQLKLLCGADFMDSFKVPGLWTDEHIEEVVGRFGLVCVSRGSLQPDRAIHESDLLSKH 178

  Fly   235 QSNITLITNWVPNEVSSTLIRRLLGRGQSVKYLLDDLVLEYIKRQRLFNFKSK 287
            :.:|.|:..||.||:|:|.|||.|.||.||||||.|.|:|||:..:|:...|:
Zfish   179 RPSIFLVREWVHNEISATEIRRALRRGHSVKYLLPDSVIEYIREHKLYTQDSE 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 103/242 (43%)
nmnat3XP_700826.3 NMNAT_Eukarya 7..226 CDD:185681 103/242 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C18042599
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 1 1.000 H39772
Inparanoid 1 1.050 233 1.000 Inparanoid score I3322
OMA 1 1.010
OrthoDB 1 1.010 D1308027at2759
OrthoFinder 1 1.000 FOG0001264
OrthoInspector 1 1.000 T597308
orthoMCL 1 0.900 OOG5_128044
Panther 1 1.100 O PTHR12039
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R815
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.