DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and nmnat1

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_012822083.1 Gene:nmnat1 XenbaseID:XB-GENE-993368 Length:320 Species:Xenopus tropicalis

Alignment Length:295 Identity:120/296 (41%)
Similarity:165/296 (56%) Gaps:34/296 (11%)


  Fly    40 KSLLP-----------RIAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYG 93
            :||||           .:..:|.|.|:|.|.||||:||:|:|:....|.::|:.|||||..|.|.
 Frog    37 QSLLPPQNMEKSDDRREVVLLATGSFNPITVMHLRLFELARDYLHETGKYKVIKGIISPVGDGYK 101

  Fly    94 KKGLASALDRCAMVKLATQSSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSGGGGGDDGE 158
            ||||..|..|.||..|||::||||.:..||..|.:||.|..||:|||..:.|...|     |..|
 Frog   102 KKGLIEASHRLAMANLATKNSNWIEVDSWECSQKEWMETVLVLRHHQQKLANANTS-----DSSE 161

  Fly   159 N-THLPGW-----------LPRGLHDSRDPVHLKLLCGADLLESFAVPGLWAEADIEDIVANHGL 211
            . .|..|.           ..|.|.:|:....:|||||||:|||...|.||...|:.:|:::.|:
 Frog   162 KVVHKKGHKRKRENSYQDKTDRCLQESKVMPQVKLLCGADMLESLGKPNLWKNEDVIEILSSFGI 226

  Fly   212 VVITRAGSNPGKFIFDSDILTKYQSNITLITNWVPNEVSSTLIRRLLGRGQSVKYLLDDLVLEYI 276
            |.|||.|||...||::||||.||:..|.|:..|:.|::|||.|||.|.||.|::||:.|.|:|||
 Frog   227 VCITRLGSNASNFIYESDILWKYKHMIHLVEEWITNDISSTKIRRALRRGMSIRYLVPDSVVEYI 291

  Fly   277 KRQRLFNFKSKYITDAVRPNHLLFNHAYTDNNKNA 311
            :...|:|.:|:      ..|..:.......|:||:
 Frog   292 ENHELYNERSE------ERNSGIILEPLARNSKNS 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 110/248 (44%)
nmnat1XP_012822083.1 NMNAT_Eukarya 54..297 CDD:185681 110/248 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C18040101
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3410
OMA 1 1.010
OrthoDB 1 1.010 D1308027at2759
OrthoFinder 1 1.000 FOG0001264
OrthoInspector 1 1.000 T1059872
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R815
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.