DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and NMNAT3

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001307439.1 Gene:NMNAT3 HGNCID:20989 Length:346 Species:Homo sapiens

Alignment Length:340 Identity:115/341 (34%)
Similarity:156/341 (46%) Gaps:111/341 (33%)


  Fly    40 KSLLPRIAFIACGCFSPPTPMHLRMFEIAKDHF-------------------------------- 72
            ||.:| :..:|||.|:|.|.|||||||:|:||.                                
Human     2 KSRIP-VVLLACGSFNPITNMHLRMFEVARDHLHQTEYEEKDHEVALVFPGPQSISIKDISFHLQ 65

  Fly    73 --------------------------------------------------------------EMQ 75
                                                                          .:|
Human    66 KRIQNNVSSKNDDPDKSSFKRKRTEEQAFCDLNDSKCKGTTLKKIIFIDSTWNQTNKIFTDERLQ 130

  Fly    76 GTHRVVGGIISPTHDSYGKKGLASALDRCAMVKLATQSSNWIRLSDWEVHQNQWMRTQAVLQHHQ 140
            |.::|:.|||||.:|:||||.||::..|.||.:||.|:|:|||:..||..|.|||.|..||:||.
Human   131 GMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHH 195

  Fly   141 NYINNHINSGG--GGGDDGENT-HLPGWLPRGLHDSRDPVHLKLLCGADLLESFAVPGLWAEADI 202
            :.:   :.|..  .|.|.|:.. ..|..:|          .||||||||:|::|..|.||.:|.|
Human   196 SKL---LRSPPQMEGPDHGKALFSTPAAVP----------ELKLLCGADVLKTFQTPNLWKDAHI 247

  Fly   203 EDIVANHGLVVITRAGSNPGKFIFDSDILTKYQSNITLITNWVPNEVSSTLIRRLLGRGQSVKYL 267
            ::||...|||.:.|.|.:|..:|.:|.||..:|.||.|....|.||:|:|.|||.||:|||||||
Human   248 QEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYL 312

  Fly   268 LDDLVLEYIKRQRLF 282
            :.|.|:.|||...|:
Human   313 IPDAVITYIKDHGLY 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 112/333 (34%)
NMNAT3NP_001307439.1 NMNAT_Eukarya 7..327 CDD:185681 112/333 (34%)
DTW <35..>135 CDD:294749 2/100 (2%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C18042283
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3523
Isobase 1 0.950 0 Normalized mean entropy S1288
OMA 1 1.010
OrthoDB 1 1.010 D1308027at2759
OrthoFinder 1 1.000 FOG0001264
OrthoInspector 1 1.000 T609642
orthoMCL 1 0.900 OOG5_128044
Panther 1 1.100 O PTHR12039
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.720

Return to query results.
Submit another query.