DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and nmnat2

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_956298.1 Gene:nmnat2 ZFINID:ZDB-GENE-030131-8201 Length:304 Species:Danio rerio

Alignment Length:307 Identity:98/308 (32%)
Similarity:147/308 (48%) Gaps:71/308 (23%)


  Fly    37 EETKSLLPRIAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKKGLASAL 101
            |.||:   .:..::||.|:|.|..|:.|||.|:::....|...|:|||:||.||||||.||..:.
Zfish     3 ENTKT---HVILLSCGSFNPITKGHIHMFEKAREYLHKTGRFIVIGGIVSPVHDSYGKPGLVPSR 64

  Fly   102 DRCAMVKLATQSSNWIRLSDWEVHQNQWMRTQAVLQHH--------------------------- 139
            .|..|.:||.|||:|||:..||.:|:.|..|.:||:||                           
Zfish    65 HRLTMCQLAVQSSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTPSTTPVIGQP 129

  Fly   140 --------QNYINNHINSGGGGG---------------------DDGENTHLPGWLPRGLHDSRD 175
                    ||.:|..:.....|.                     |:..|      |...:.....
Zfish   130 QNETSAIYQNTVNKSVAIKFWGKMSESLGKICCVRPHMDRFTFVDENAN------LGTAMRYEEI 188

  Fly   176 PVHLKLLCGADLLESFAVPGLWAEADIEDIVANHGLVVITRAGSNPGKFIFDSDILTKYQSNITL 240
            .:.:.||||:||||||.:||||.|:|:|.||.:.|:||:.|.|::..:.:..|.:|.|::.||.:
Zfish   189 ELRILLLCGSDLLESFCIPGLWNESDMEVIVGDFGIVVVPRDGADTERIMNHSSVLRKHKDNIIV 253

  Fly   241 ITNWVPNE---VSSTLIRRLL--GRGQSVKYLLDDLVLEYIKRQRLF 282
            :.:.:.:.   ||||..|..|  |.|..|.| |...|::||.:.:|:
Zfish   254 VKDEIDHPMSIVSSTKSRLALQHGDGHVVDY-LSQPVIDYILQSQLY 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 95/297 (32%)
nmnat2NP_956298.1 NMNAT_Eukarya 9..299 CDD:185681 95/297 (32%)
Substrate binding. {ECO:0000250|UniProtKB:Q96T66} 55..57 2/2 (100%)
Substrate binding. {ECO:0000250|UniProtKB:Q96T66} 92..95 1/3 (33%)
Substrate binding. {ECO:0000250|UniProtKB:Q96T66} 209..210 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1308027at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12039
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R815
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.