DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and Nmnat1

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_006239491.1 Gene:Nmnat1 RGDID:1310996 Length:316 Species:Rattus norvegicus

Alignment Length:299 Identity:125/300 (42%)
Similarity:175/300 (58%) Gaps:47/300 (16%)


  Fly    25 RRSKSKKM--------SAFIEETKSLLP-------RIAFIACGCFSPPTPMHLRMFEIAKDHFEM 74
            |||.|:.:        ...:::...|||       .:..:|||.|:|.|.||||:||:|||:...
  Rat     4 RRSSSEMLDDNNIGIRGLHLDQQLQLLPMDSSKKTEVVLLACGSFNPITNMHLRLFELAKDYLNA 68

  Fly    75 QGTHRVVGGIISPTHDSYGKKGLASALDRCAMVKLATQSSNWIRLSDWEVHQNQWMRTQAVLQHH 139
            .|.::|:.|||||..|:|.||||..|..|..|.:|||::|:|:.:..||..|.:|:.|..||:||
  Rat    69 TGEYKVIKGIISPVGDAYKKKGLIPAHHRIIMAELATKNSHWVEVDTWESLQKEWVETVKVLRHH 133

  Fly   140 QNYINNHINSGGGGGDDGENTH--------LPG----WLPRGLHDS----RDP-----VHLKLLC 183
            |..:..           |..:|        .||    |..:....|    ::|     ..:||||
  Rat   134 QEKLAT-----------GSRSHPQSSPVLERPGRKRKWADQKQDSSPQKPQEPKPTGVPRVKLLC 187

  Fly   184 GADLLESFAVPGLWAEADIEDIVANHGLVVITRAGSNPGKFIFDSDILTKYQSNITLITNWVPNE 248
            ||||||||:||.||...||..||||.||:.:|||||:..|||::||:|.::||||.|:|.|:.|:
  Rat   188 GADLLESFSVPNLWKMEDITQIVANFGLICVTRAGSDAQKFIYESDVLWRHQSNIHLVTEWITND 252

  Fly   249 VSSTLIRRLLGRGQSVKYLLDDLVLEYIKRQRLFNFKSK 287
            :|||.|||.|.||||::||:.|||.|||:...|:|.:|:
  Rat   253 ISSTKIRRALRRGQSIRYLVPDLVQEYIEEHDLYNSESE 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 116/257 (45%)
Nmnat1XP_006239491.1 NMNAT_Eukarya 40..286 CDD:185681 116/257 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C18041761
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3380
OMA 1 1.010
OrthoDB 1 1.010 D1308027at2759
OrthoFinder 1 1.000 FOG0001264
OrthoInspector 1 1.000 T618583
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12039
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.