DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and Nmnat2

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001041507.1 Gene:Nmnat2 RGDID:1307331 Length:307 Species:Rattus norvegicus

Alignment Length:310 Identity:102/311 (33%)
Similarity:152/311 (49%) Gaps:74/311 (24%)


  Fly    37 EETKSLLPRIAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKKGLASAL 101
            |.||:   .:..:|||.|:|.|..|::|||.|:|:....|...|:|||:||.||||||:||.|:.
  Rat     3 ETTKT---HVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGLVSSR 64

  Fly   102 DRCAMVKLATQSSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSGGGGGDDGENTHLPGWL 166
            .|..|.:||.|:|:|||:..||.:|:.|..|.:||:||::.:....      |....|.:.|...
  Rat    65 HRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVT------GCILSNVNTPSMT 123

  Fly   167 P---RGLHDSRDPVH-------------------------------------------------- 178
            |   :..|::..|::                                                  
  Rat   124 PVIGQPQHENTQPIYQNSNVPTKPTAAKILGKVGESLGRICCVRPPVERFTFVDENANLGTVMRY 188

  Fly   179 ------LKLLCGADLLESFAVPGLWAEADIEDIVANHGLVVITRAGSNPGKFIFDSDILTKYQSN 237
                  :.||||:||||||.:||||.|||:|.||.:.|:||:.|..::..:.:..|.||.||::|
  Rat   189 EEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADADRIMNHSSILRKYKNN 253

  Fly   238 ITLI---TNWVPNEVSSTLIRRLL--GRGQSVKYLLDDLVLEYIKRQRLF 282
            |.::   .|...:.||||..|..|  |.|..|.| |...|::||.:.:|:
  Rat   254 IMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDY-LSQPVIDYILKSQLY 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 99/300 (33%)
Nmnat2NP_001041507.1 NMNAT_Eukarya 9..302 CDD:185681 99/300 (33%)
Substrate binding. {ECO:0000250|UniProtKB:Q96T66} 55..57 2/2 (100%)
Substrate binding. {ECO:0000250|UniProtKB:Q96T66} 92..95 1/3 (33%)
Substrate binding. {ECO:0000250|UniProtKB:Q96T66} 212..213 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1308027at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12039
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.