DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and NMNAT2

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_055854.1 Gene:NMNAT2 HGNCID:16789 Length:307 Species:Homo sapiens

Alignment Length:310 Identity:106/311 (34%)
Similarity:158/311 (51%) Gaps:74/311 (24%)


  Fly    37 EETKSLLPRIAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKKGLASAL 101
            |.||:   .:..:|||.|:|.|..|::|||.|:|:....|...|:|||:||.||||||:||.|:.
Human     3 ETTKT---HVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGLVSSR 64

  Fly   102 DRCAMVKLATQSSNWIRLSDWEVHQNQWMRTQAVLQHHQN------------------------- 141
            .|..|.:||.|:|:|||:..||.:|:.|..|.:||:||::                         
Human    65 HRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTPSMTPVIGQP 129

  Fly   142 --------YINNHINSG-------GGGGDD-----------------GENTHLPGWLPRGLHDSR 174
                    |.|:::.:.       |..|:.                 .||.:| |.:.|     .
Human   130 QNETPQPIYQNSNVATKPTAAKILGKVGESLSRICCVRPPVERFTFVDENANL-GTVMR-----Y 188

  Fly   175 DPVHLK--LLCGADLLESFAVPGLWAEADIEDIVANHGLVVITRAGSNPGKFIFDSDILTKYQSN 237
            :.:.|:  ||||:||||||.:||||.|||:|.||.:.|:||:.|..::..:.:..|.||.||::|
Human   189 EEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNN 253

  Fly   238 ITLI---TNWVPNEVSSTLIRRLL--GRGQSVKYLLDDLVLEYIKRQRLF 282
            |.::   .|...:.||||..|..|  |.|..|.| |...|::||.:.:|:
Human   254 IMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDY-LSQPVIDYILKSQLY 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 103/300 (34%)
NMNAT2NP_055854.1 NMNAT_Eukarya 9..302 CDD:185681 103/300 (34%)
Substrate binding. {ECO:0000250|UniProtKB:Q96T66} 55..57 2/2 (100%)
Substrate binding. {ECO:0000250|UniProtKB:Q96T66} 92..95 1/3 (33%)
Substrate binding. {ECO:0000250|UniProtKB:Q96T66} 212..213 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1308027at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12039
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R815
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.