DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and Nmnat2

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_780669.1 Gene:Nmnat2 MGIID:2444155 Length:307 Species:Mus musculus

Alignment Length:310 Identity:102/311 (33%)
Similarity:152/311 (49%) Gaps:74/311 (24%)


  Fly    37 EETKSLLPRIAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKKGLASAL 101
            |.||:   .:..:|||.|:|.|..|::|||.|:|:....|...|:|||:||.||||||:||.|:.
Mouse     3 ETTKT---HVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGLVSSR 64

  Fly   102 DRCAMVKLATQSSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSGGGGGDDGENTHLPGWL 166
            .|..|.:||.|:|:|||:..||.:|:.|..|.:||:||::.:....      |....|.:.|...
Mouse    65 HRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVT------GCILSNVNTPSMT 123

  Fly   167 P---RGLHDSRDPVH-------------------------------------------------- 178
            |   :..|::..|::                                                  
Mouse   124 PVIGQPQHENTQPIYQNSNVPTKPTAAKILGKVGESLSRICCVRPPVERFTFVDENANLGTVMRY 188

  Fly   179 ------LKLLCGADLLESFAVPGLWAEADIEDIVANHGLVVITRAGSNPGKFIFDSDILTKYQSN 237
                  :.||||:||||||.:||||.|||:|.||.:.|:||:.|..::..:.:..|.||.||::|
Mouse   189 EEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNN 253

  Fly   238 ITLI---TNWVPNEVSSTLIRRLL--GRGQSVKYLLDDLVLEYIKRQRLF 282
            |.::   .|...:.||||..|..|  |.|..|.| |...|::||.:.:|:
Mouse   254 IMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDY-LSQPVIDYILKSQLY 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 99/300 (33%)
Nmnat2NP_780669.1 NMNAT_Eukarya 9..302 CDD:185681 99/300 (33%)
Substrate binding. {ECO:0000250|UniProtKB:Q96T66} 55..57 2/2 (100%)
Substrate binding. {ECO:0000250|UniProtKB:Q96T66} 92..95 1/3 (33%)
Substrate binding. {ECO:0000250|UniProtKB:Q96T66} 212..213 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12039
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R815
TreeFam 1 0.960
54.990

Return to query results.
Submit another query.