DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and nmat-1

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_510010.2 Gene:nmat-1 WormBaseID:WBGene00012295 Length:220 Species:Caenorhabditis elegans

Alignment Length:245 Identity:85/246 (35%)
Similarity:123/246 (50%) Gaps:37/246 (15%)


  Fly    45 RIAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKKGLASALDRCAMVKL 109
            ::..:|.|.|:|||..||.|.|.||...|..| ..|:.||:||..|.|.||.|.||..|.|..:.
 Worm     5 KVVILAVGSFNPPTNGHLCMMEDAKYSLEKSG-KIVLEGIMSPVSDGYAKKSLISAKHRLAQTEA 68

  Fly   110 ATQSSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSGGGGGDDGENTHLPGWLPRGLHDSR 174
            ||..|:||..|.||..|::|..|..||:|||..:.|.:.|                         
 Worm    69 ATYDSDWIHASGWECAQSEWTATVNVLKHHQQDVKNKLGS------------------------- 108

  Fly   175 DPVHLKLLCGADLLESF------AVPGLWAEADIEDIVANHGLVVITRAGSNPGKFIFDSDILTK 233
             .|::.||.|.|::|||      ..| :|...|:|:|: :.|:||.:|.||:|.:.:...: |.:
 Worm   109 -DVNVLLLFGGDVIESFDKFYADGTP-VWDREDVEEII-SAGIVVRSRPGSDPEQTLKKLN-LNE 169

  Fly   234 YQSNITLITNWV-PNEVSSTLIRRLLGRGQSVKYLLDDLVLEYIKRQRLF 282
            ....:..|.|.: .|.:|||.:|..|...:|:||...|.|::|||..||:
 Worm   170 NSDKVHFIKNAISSNSISSTSLRAALKEHRSIKYTTPDSVIKYIKDHRLY 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 85/243 (35%)
nmat-1NP_510010.2 nt_trans 6..219 CDD:294020 85/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 1 1.000 H39772
Inparanoid 1 1.050 135 1.000 Inparanoid score I3108
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1308027at2759
OrthoFinder 1 1.000 FOG0001264
OrthoInspector 1 1.000 T374757
orthoMCL 1 0.900 OOG5_128044
Panther 1 1.100 O PTHR12039
Phylome 1 0.910 0.755 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R815
TreeFam 1 0.960
1312.870

Return to query results.
Submit another query.