DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and nmat-2

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_492480.1 Gene:nmat-2 WormBaseID:WBGene00009176 Length:223 Species:Caenorhabditis elegans

Alignment Length:247 Identity:85/248 (34%)
Similarity:127/248 (51%) Gaps:34/248 (14%)


  Fly    43 LPRIAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKK-GLASALDRCAM 106
            :.|:|.:|.|.|:|||..||||.|:|:.|.|...| :||.||:||..|||..| .|..:..|..|
 Worm     1 MKRVALLAVGSFNPPTIAHLRMLEVARSHLETINT-QVVEGIMSPVADSYNNKPTLIKSNFRIQM 64

  Fly   107 VKLATQSSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSGGGGGDDGENTHLPGWLPRGLH 171
            |:.||:||:|||..|||..:..|.||..||:||:..:.....|..|                   
 Worm    65 VRAATKSSDWIRADDWECTRTTWTRTIDVLRHHRELVQEKFGSDVG------------------- 110

  Fly   172 DSRDPVHLKLLCGADLLESFA--VP---GLWAEADIEDIVANHGLVVITRAGSNPGKFIFDSDIL 231
                   :.|:.|.|:::||.  :|   .||..:||..|:...||:|::|.||||...|.....:
 Worm   111 -------MMLVVGGDVVDSFTRILPDGSNLWNSSDIRTIITEFGLIVLSREGSNPLNTIQSMPAI 168

  Fly   232 TKYQSNITLITNWV-PNEVSSTLIRRLLGRGQSVKYLLDDLVLEYIKRQRLF 282
            :::...|..:.:.| |:.||||.:|..:...:|:||...|.|:.:|:...|:
 Worm   169 SEFCDRIIQVKDEVCPSGVSSTRLRAAIMNKKSIKYSTPDEVINFIRENNLY 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 84/243 (35%)
nmat-2NP_492480.1 NMNAT_Eukarya 4..220 CDD:185681 84/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 1 1.000 H39772
Inparanoid 1 1.050 135 1.000 Inparanoid score I3108
Isobase 1 0.950 0 Normalized mean entropy S1288
OMA 1 1.010
OrthoDB 1 1.010 D1308027at2759
OrthoFinder 1 1.000 FOG0001264
OrthoInspector 1 1.000 T374757
orthoMCL 1 0.900 OOG5_128044
Panther 1 1.100 LDO PTHR12039
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R815
TreeFam 1 0.960
1312.910

Return to query results.
Submit another query.