DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-S and pigs

DIOPT Version :8

Sequence 1:NP_733060.1 Gene:PIG-S / 42979 FlyBaseID:FBgn0265190 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001070082.1 Gene:pigs / 767675 ZFINID:ZDB-GENE-060929-436 Length:566 Species:Danio rerio

Alignment Length:564 Identity:167/565 (30%)
Similarity:266/565 (47%) Gaps:71/565 (13%)


  Fly    25 ATLAFIVVIIGIGVPMWWRTTTVYRVNLPSTEILSLSKIPIKTAVQVAIYTQQTSRGQLLIAELQ 89
            |.||...|:|.:|:|:||:||..||..||.::|..|..:.::.:|.:.:.   .||| .|..|.|
Zfish    19 AALAIAAVVIIVGIPLWWKTTETYRAWLPFSDINELDSLQLRLSVDIEVV---FSRG-TLTPEQQ 79

  Fly    90 NAFSDNEI--------------WSVEFKQLSPTPMTQEA-HTPAALE-----KLLLENHVQSVGD 134
            .....:.:              :..|.:..:.|.|.::| :.|.|.|     ..|.|:...||..
Zfish    80 KKIPLSHVNEKEHQVDAKTGLRYQYETRYRTATVMEEDALNQPTAAEADLSLHTLTESSCGSVVV 144

  Fly   135 FMFIEWPKLQEE---LLLTTERSALMRSDTPSNKIAQLLHAKILQ-TYRINQILST--------- 186
            ::..|...|..|   :.:...|:||:||  |..|.:..|:..|.. ..|:.||.||         
Zfish   145 YVIPESSVLLPEDVKVYVGQRRTALLRS--PPFKSSWSLNEVISNLNPRVEQIASTMSFSHQDIT 207

  Fly   187 ------------------DERMGAKSEAPQPAYDVIVSVLNPKPRLTHAKWNIAMAVKTYIEPWL 233
                              |.....||   .|.|::..|:|||.|:.....|:|..|:.:||:|.|
Zfish   208 AALSDRVRMTKVTKESMADSMRAIKS---SPGYEITFSLLNPDPKSHSLHWDIEGALHSYIQPLL 269

  Fly   234 AKVSGVSNYTVRSQWKYRVAIEADLKQVRDQSKLGRHYALQETALPHLLTSIAQNL-SASTTDKP 297
            .|::.::|::|.||..|...:..:.:.....|.    |.|...:|.|::..:...| |.:.:..|
Zfish   270 NKLAPIANFSVDSQILYYAVLGVNPRFDNSVSA----YTLNADSLSHVINPVEARLGSNAASSNP 330

  Fly   298 AINLVVYIPPCHIAPLHIYNSKDQRLTRNDVDAFISPPWGGFIIANPPEHVCLAAMSDQEAVPYH 362
            .:|.::|:|..|.:||.|.:...:.:..|   ||.||.|||.::.|..:   |.....:..|...
Zfish   331 VLNFLLYVPDAHHSPLFIRDHSRREVPTN---AFHSPRWGGIMVYNVND---LYGPESERPVDIS 389

  Fly   363 VSTTDNMQVMLDQLHKLLDISSELQMEGVKVVDIEQLEPRRWEYEAYLRRSAIRHISTASSTLQS 427
            ::....|.|.|.||..:|.:.......|..:..........||.:..:...::.:|:|||:|:.|
Zfish   390 INMAKVMGVFLAQLRLMLGVHQTHPPSGFVLQSPGSAGLADWELDRLMWSRSVENIATASTTITS 454

  Fly   428 LIKLLDQISYIVIDDEVGAAITNSYADILAAKAALLEHRLADASVLAKRAFVASERGFFDASLLA 492
            |.:|||||..|||:|.:...::::...:.||.|.|....|..|...::.|.:||||.|||.|||.
Zfish   455 LAQLLDQIGNIVINDNIALQVSSAVTSLQAAVAELDAGNLVFALQYSREAILASERAFFDPSLLH 519

  Fly   493 QLYFPDEQKYAIYIPLFLPIMVPVLSSFNMLRGVLQARRKEKQS 536
            .|||||:||:|||||||||:.||::.|...:...::.||.|||:
Zfish   520 LLYFPDDQKFAIYIPLFLPMCVPIVLSLLKIVSEVKKRRAEKQA 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-SNP_733060.1 PIG-S 28..521 CDD:287481 160/545 (29%)
pigsNP_001070082.1 PIG-S 31..557 CDD:287481 157/545 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C301651721
eggNOG 1 0.900 E1_KOG2459
Hieranoid 1 1.000
Homologene 1 1.000 H41963
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1399804at2759
OrthoFinder 1 1.000 FOG0004408
OrthoInspector 1 1.000 T1053097
orthoMCL 1 0.900 OOG5_130524
Panther 1 1.100 LDO PTHR21072
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R923
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.