DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-S and ofd1

DIOPT Version :8

Sequence 1:NP_733060.1 Gene:PIG-S / 42979 FlyBaseID:FBgn0265190 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_596087.1 Gene:ofd1 / 2541179 PomBaseID:SPBC6B1.08c Length:515 Species:Schizosaccharomyces pombe

Alignment Length:431 Identity:85/432 (20%)
Similarity:133/432 (31%) Gaps:156/432 (36%)


  Fly   109 PMTQEAHTPAAL-----EKLLLENHVQSVGDFMFIEWPKLQEELLLTTERSALMRSDTPSNKIAQ 168
            |...:...|.||     |:|..|.|..  |.:..:....|..:.||...|..||.:         
pombe     7 PTVLDRFAPHALDTSEAERLSREYHKN--GPYNHVVIRPLINDTLLRNVRKELMEN--------- 60

  Fly   169 LLH--AKILQTYRINQILSTDERMGAKSEAPQPAYDVIVSVLNPKPRLTHAKWNIAMAVKTYIEP 231
             :|  .|:...||:                                      |....        
pombe    61 -IHFTEKVTDIYRV--------------------------------------WQTGD-------- 78

  Fly   232 WLAKVSGVSNYTVRSQWKYRVAIEADLKQVRD--QSKLGRHYALQETALPHLLTSIAQNLSASTT 294
             ||.:.|:.. ..::..||       |:||||  .|:..|.:..:.|.        ...||||..
pombe    79 -LANLDGLDK-KEQNMLKY-------LRQVRDALYSEEFRSHVQKITG--------CGPLSASKK 126

  Fly   295 DKPAINLVVYIPPCHIAPLHIYNSKDQRLTR--------NDVDAFISPPWGGFIIANPPEHVCLA 351
            |   :::.||...|     |:.|..|...||        .:.|....|.:||.:...|.......
pombe   127 D---LSVNVYSKGC-----HLMNHDDVIGTRCISYILYLVEPDEGWKPEYGGALRLFPTLQPSFP 183

  Fly   352 AMSDQEAVPYHVSTTDNMQVMLDQLHKLLDISSELQMEGVKVVDIEQL---EPRR----W----- 404
            |.....::|...:.....:|                ..|....|:|::   :||.    |     
pombe   184 AADFCHSIPPQWNQLSFFRV----------------KPGHSFHDVEEVYVDKPRMAISGWFHYPQ 232

  Fly   405 ----EYEAYLRRSAIRHISTASSTLQSL-IKLLD----QISYI-VIDDEVGAAITNSYADILAAK 459
                .|:|       .:.....|||||| :|.:|    :.||. |:..|   .::....|||:..
pombe   233 PGEPGYDA-------NYCDNTVSTLQSLTMKQMDLELPRFSYYPVVKPE---PLSKQDTDILSNY 287

  Fly   460 AALLEHRLADASVLAKRAFVASERGFFDASLLAQLYFPDEQ 500
            ...|.........|:||        ||..|::..:.|.:::
pombe   288 INPLYLTPDGIEKLSKR--------FFQDSVIVLVEFLNQE 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-SNP_733060.1 PIG-S 28..521 CDD:287481 85/432 (20%)
ofd1NP_596087.1 EGL9 3..241 CDD:226274 62/340 (18%)
Ofd1_CTDD 280..515 CDD:287592 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I1436
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1124951
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R866
TreeFam 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.