DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycB3 and CYCA1;2

Sequence 1:NP_001262934.1 Gene:CycB3 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_177863.2 Gene:CYCA1;2 AraportID:AT1G77390 Length:442 Species:Arabidopsis thaliana

Alignment Length:543 Identity:151/544 (28%)
Similarity:231/544 (42%) Gaps:136/544 (25%)


  Fly    55 MQTRAKRKADHSPIKNDKI------------KRSALGNLTNNVKIMTLHPAQDEEQSGVGKKPTA 107
            |.:.::..:..:||....:            :|:.||::||                        
plant     1 MSSSSRNLSQENPIPRPNLAKTRTSLRDVGNRRAPLGDITN------------------------ 41

  Fly   108 QQLQALMDAKKQENLSVNVFGASKMTTRASSKVEDSVENCHKVLDKLEEALARPKPRPKAVPAAK 172
                       |:|.|.|...:|.:.            ||       ...:.:.|..||      
plant    42 -----------QKNGSRNPSPSSTLV------------NC-------SNKIGQSKKAPK------ 70

  Fly   173 KTVLGEVQLPAMPNPMQIPVL---LPPTHNLAAPQVAAVKPVRRISNDFNKTEDSLYMSALEDVS 234
                     ||:.....:.:|   |||..|..:..:...:....:.:|     |||.        
plant    71 ---------PALSRNWNLGILDSGLPPKPNAKSNIIVPYEDTELLQSD-----DSLL-------- 113

  Fly   235 SCDSMRLSGNFEAARRRSAKLQQKTEQQPQPLLLTLPETAPSQVVP--IPPVPEEVEDFDRK--- 294
             |.|..||  .:|:         .|:..|.   ::..::..:.||.  :....::..|.|..   
plant   114 -CSSPALS--LDAS---------PTQSDPS---ISTHDSLTNHVVDYMVESTTDDGNDDDDDEIV 163

  Fly   295 NWD----DPFQVSHYAMDIFNYLKVREA-EFPIADYMPR-QIHLTTWMRTLLVDWMVEVQETFEL 353
            |.|    ||...:.:|.||:.:|:|.|. :.|..|||.| |..:...||::|:||:|||.|.:.|
plant   164 NIDSDLMDPQLCASFACDIYEHLRVSEVNKRPALDYMERTQSSINASMRSILIDWLVEVAEEYRL 228

  Fly   354 NHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELV 418
            :.|||||||..||.||....|||:.|||||.....||.||:|...|.:|||.||.|..|..:||:
plant   229 SPETLYLAVNYVDRYLTGNAINKQNLQLLGVTCMMIAAKYEEVCVPQVEDFCYITDNTYLRNELL 293

  Fly   419 RMERETLRVIKYDLGIPLSYRFLRRYARCA--KVPMPTL---TLARYILELSLMDYANISFSDSQ 478
            .||...|..:|::|..|.:..||||:.|.|  :..:|:|   .||.|:.||||:|||.:.::.|.
plant   294 EMESSVLNYLKFELTTPTAKCFLRRFLRAAQGRKEVPSLLSECLACYLTELSLLDYAMLRYAPSL 358

  Fly   479 MASAALFMA-LRMHGGPGQLDKQTWTSTLIYYTGYQLADFAEIVTALNAGLHRKPRATIKTIRNK 542
            :|::|:|:| ..:|.     .::.|.:||.:||.|:.......|..|....:.|..:.:..||.|
plant   359 VAASAVFLAQYTLHP-----SRKPWNATLEHYTSYRAKHMEACVKNLLQLCNEKLSSDVVAIRKK 418

  Fly   543 YSHKIFHEVAK--VPLLTNQELF 563
            ||...:...||  .|....||||
plant   419 YSQHKYKFAAKKLCPTSLPQELF 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 60/127 (47%)
Cyclin_C 435..555 CDD:281044 41/128 (32%)
CYCA1;2NP_177863.2 Cyclin_N 181..308 CDD:278560 60/127 (47%)
Cyclin_C 310..433 CDD:281044 41/128 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 1 1.000 T124444
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10177
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.