DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7006 and C43E11.9

DIOPT Version :9

Sequence 1:NP_651296.1 Gene:CG7006 / 42963 FlyBaseID:FBgn0039233 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_491342.1 Gene:C43E11.9 / 172028 WormBaseID:WBGene00016607 Length:180 Species:Caenorhabditis elegans


Alignment Length:179 Identity:95/179 - (53%)
Similarity:127/179 - (70%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRLSDERAKILFEHLSKYIGTNVKHLIDRPDGTYCFREHKDRVYYVSERILKLSECFGYKQLVC 65
            |:.|::|...::|..|:.:||.||..||||.||.||||.||:||||.||.:::.:.|...:.|:.
 Worm     1 MRPLTEEETSLVFAKLASFIGDNVSMLIDRNDGDYCFRNHKERVYYCSENLMRQAACIAREPLLS 65

  Fly    66 VGTCFGKFSKTNKLKFHITALYYLAPYAQYKVWVKPSFEQQFLYGNHIPKTGLGRITENAGQYQG 130
            .|||.|||:|:.|....||||.||||||::|||:||:.||||||||:|.|:|:.|:|:....:.|
 Worm    66 FGTCLGKFTKSKKFHLQITALDYLAPYAKFKVWLKPNAEQQFLYGNNILKSGIARMTDGTPTHAG 130

  Fly   131 VVVYSMNDLPLGFGVLARSTTDCKTADPMTTVCFHQSDIGEYIRAEDTL 179
            :|||||.|:||||||.|:.|:|.|.|||...|..||.|:|||:|.|..|
 Worm   131 IVVYSMTDVPLGFGVSAKGTSDSKRADPTALVVLHQCDLGEYLRNESHL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7006NP_651296.1 PUA 1..177 CDD:294405 93/175 (53%)
C43E11.9NP_491342.1 NIP7 1..176 CDD:224293 93/174 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167359
Domainoid 1 1.000 104 1.000 Domainoid score I4227
eggNOG 1 0.900 - - E1_COG1374
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56743
Inparanoid 1 1.050 207 1.000 Inparanoid score I2414
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53780
OrthoDB 1 1.010 - - D1405073at2759
OrthoFinder 1 1.000 - - FOG0005084
OrthoInspector 1 1.000 - - oto17485
orthoMCL 1 0.900 - - OOG6_102224
Panther 1 1.100 - - LDO PTHR23415
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R812
SonicParanoid 1 1.000 - - X3604
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.