DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7006 and nip7

DIOPT Version :9

Sequence 1:NP_651296.1 Gene:CG7006 / 42963 FlyBaseID:FBgn0039233 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001096512.1 Gene:nip7 / 100125143 XenbaseID:XB-GENE-1005412 Length:180 Species:Xenopus tropicalis


Alignment Length:179 Identity:124/179 - (69%)
Similarity:145/179 - (81%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRLSDERAKILFEHLSKYIGTNVKHLIDRPDGTYCFREHKDRVYYVSERILKLSECFGYKQLVC 65
            |:.|:||..|.:||.||||||.|:|.|:||||||||||.|.|||||||||||||:......:||.
 Frog     1 MRPLTDEETKAMFEKLSKYIGENIKLLVDRPDGTYCFRLHNDRVYYVSERILKLATNIARDKLVS 65

  Fly    66 VGTCFGKFSKTNKLKFHITALYYLAPYAQYKVWVKPSFEQQFLYGNHIPKTGLGRITENAGQYQG 130
            :|||||||:||:|.:.|:|||.||||||:|||||||..||.||||||:.|:||||||||..||||
 Frog    66 LGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWVKPGAEQSFLYGNHVLKSGLGRITENTSQYQG 130

  Fly   131 VVVYSMNDLPLGFGVLARSTTDCKTADPMTTVCFHQSDIGEYIRAEDTL 179
            ||||||.|:||||||.|:||.:|:..|||..|.|||:|:|||||.||||
 Frog   131 VVVYSMADIPLGFGVAAKSTQECRKLDPMAIVVFHQADVGEYIRHEDTL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7006NP_651296.1 PUA 1..177 CDD:294405 120/175 (69%)
nip7NP_001096512.1 NIP7 1..177 CDD:224293 120/175 (69%)
N-terminal domain. /evidence=ECO:0000250 1..92 59/90 (66%)
C-terminal domain. /evidence=ECO:0000250 93..180 63/87 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5313
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56743
Inparanoid 1 1.050 266 1.000 Inparanoid score I2972
OMA 1 1.010 - - QHG53780
OrthoDB 1 1.010 - - D1405073at2759
OrthoFinder 1 1.000 - - FOG0005084
OrthoInspector 1 1.000 - - oto105617
Panther 1 1.100 - - LDO PTHR23415
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R812
SonicParanoid 1 1.000 - - X3604
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.