DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lili and LMBR1

DIOPT Version :8

Sequence 1:NP_651290.1 Gene:lili / 42956 FlyBaseID:FBgn0027539 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001337882.1 Gene:LMBR1 / 64327 HGNCID:13243 Length:531 Species:Homo sapiens

Alignment Length:523 Identity:221/523 - (42%)
Similarity:321/523 - (61%) Gaps:43/523 - (8%)


  Fly     4 EEEEEVTDLKLQLFHNTVREHIIFLLLIILLYSSSYVVVSRFRRRDRDDLYSNDEDEVLVYRISF 68
            |.::||: .:.|.||:.|||..|..||..:||..||.:::|::|:..:    .::::.:|.|||.
Human     2 EGQDEVS-AREQHFHSQVRESTICFLLFAILYVVSYFIITRYKRKSDE----QEDEDAIVNRISL 61

  Fly    69 WLCTFTLAVAEGAAMLLPVSIASNEVLLLYPNSYYVKWLNSSLIQGLWNHVFLFSNLSLFIFLPF 133
            :|.||||||:.||.:|||.||.|||:||.:|.:||::|||.|||.||||...|||||.||:.:||
Human    62 FLSTFTLAVSAGAVLLLPFSIISNEILLSFPQNYYIQWLNGSLIHGLWNLASLFSNLCLFVLMPF 126

  Fly   134 VYLFSESTGFVGNKKGILPRVYETFTVFMLMAIIVLVLTAVLSAVF-----GIEKLQFFWFLNLG 193
            .:.|.||.||.|.||||..|:.||..:.:|:|:::|.:..|.||:.     .:|.|...|     
Human   127 AFFFLESEGFAGLKKGIRARILETLVMLLLLALLILGIVWVASALIDNDAASMESLYDLW----- 186

  Fly   194 SVHLPFLYSCVSFLGVMLMLICTPYGFVRLFGVVNQVLVRPMLLRDVNEEFSAFYMEEASVKRKL 258
            ..:||:||||:|.:|.:|:|:|||.|..|:|.|:.|:||:|.:|.|::|:.....:||.:::|:|
Human   187 EFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRL 251

  Fly   259 AHIELHNVSIADAAN----GGR-----LGNRIGLGR----GRTFYPQPLLQHSQAHLYQRKAMAS 310
                  ||.:..|.|    .||     ...::.||:    |......|.|..|..:         
Human   252 ------NVGMLCAGNPEVATGRQVPEEQAGQLLLGKWIQEGGDMIANPRLSSSVEY--------- 301

  Fly   311 DVDELNDRLRELDSERKELDKLRTSSTFQRTFVYPLAMLLLLFCTAVTILLVVQNTLELLIGIKA 375
            ::.||...|..:.:.:.:|::.:.:|.::|..|||..|:|||..|::::|||..|.|.||:...|
Human   302 NIMELEQELENVKTLKTKLERRKKASAWERNLVYPAVMVLLLIETSISVLLVACNILCLLVDETA 366

  Fly   376 LPLSTRQFALGISSLSKLGPFGAGLEVCLIFYLGATSVVGFYSMPFMRKVCPKRRQTSLPQLMLN 440
            :|..||...:|.:|||..|..||.||:.|||||..:|||||||:.|.....||:..|::.:::.|
Human   367 MPKGTRGPGIGNASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGN 431

  Fly   441 CGFMLVLSSALPLLSRIIGITNFDLLGDFGAIEWLGNFQIVLLYNLVFGTTTALCLANKFTATVR 505
            |..:||||||||::||.:|||.||||||||...|||||.|||.|||:|...|.|||..|||:.||
Human   432 CVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFAIVTTLCLVRKFTSAVR 496

  Fly   506 REL 508
            .||
Human   497 EEL 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
liliNP_651290.1 LMBR1 63..495 CDD:282625 193/449 (43%)
LMBR1NP_001337882.1 LMBR1 19..491 CDD:309779 207/495 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C285789850
eggNOG 1 0.900 E1_KOG3722
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 398 1.000 Inparanoid score I1925
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D334825at33208
OrthoFinder 1 1.000 FOG0002377
OrthoInspector 1 1.000 T609645
orthoMCL 1 0.900 OOG5_131616
Panther 1 1.100 O PTHR12625
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2924
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.