DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lili and lmbr1

DIOPT Version :8

Sequence 1:NP_651290.1 Gene:lili / 42956 FlyBaseID:FBgn0027539 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001011160.1 Gene:lmbr1 / 496578 XenbaseID:XB-GENE-981846 Length:485 Species:Xenopus tropicalis

Alignment Length:509 Identity:216/509 - (42%)
Similarity:308/509 - (60%) Gaps:58/509 - (11%)


  Fly     5 EEEEVTDLKLQLFHNTVREHIIFLLLIILLYSSSYVVVSRFRRRDRDDLYSNDEDEVLVYRISFW 69
            ||:||| ::.|.|::.|||.||..||..:||..||.::.|::|:..:    .::::..|.|:|.:
 Frog     2 EEDEVT-IREQNFYSQVRECIICFLLFAILYIVSYFIIKRYKRKGDE----QEDEDATVNRVSLF 61

  Fly    70 LCTFTLAVAEGAAMLLPVSIASNEVLLLYPNSYYVKWLNSSLIQGLWNHVFLFSNLSLFIFLPFV 134
            ||||||||:.||.:|||.||.|||:||.:|.|||::|||.|||.||||.|.|||||.||:.:||.
 Frog    62 LCTFTLAVSGGAVLLLPFSIISNEILLCFPKSYYIQWLNGSLIHGLWNLVSLFSNLCLFVLMPFA 126

  Fly   135 YLFSESTGFVGNKKGILPRVYETFTVFMLMAIIVLVLTAVLSAVF-----GIEKLQFFWFLNLGS 194
            :.|.||.||.|.||||..|:.||..:.:|:|:::..:..|.||:.     .:|.|...|     .
 Frog   127 FFFLESEGFAGLKKGIKARILETIIMLILLALLIFGIVWVASALIDNSSASMESLYDLW-----D 186

  Fly   195 VHLPFLYSCVSFLGVMLMLICTPYGFVRLFGVVNQVLVRPMLLRDVNEEFSAFYMEEASVKRKLA 259
            .:||:||||:|.:|.:|:|:|||.|..|:|.|:.|:||:|.:|.|::|:.....::|.:::||| 
 Frog   187 CYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPTILEDIDEQMYIISLQEEALQRKL- 250

  Fly   260 HIELHNVSIADAANGGRLGNRIGLGRGRTFYPQPLLQHSQAHLYQRKAMASDVDELNDRLRELDS 324
                         |||.             |...         |.||.:..|:  ||.|     |
 Frog   251 -------------NGGN-------------YTAD---------YSRKKIEHDL--LNAR-----S 273

  Fly   325 ERKELDKLRTSSTFQRTFVYPLAMLLLLFCTAVTILLVVQNTLELLIGIKALPLSTRQFALGISS 389
            .:.:|::.:.:|.:||..|||..|:|||..|..:::||..|.|.||:...|:|..::....|.:|
 Frog   274 MKSKLERRKNASAWQRNLVYPAVMILLLIATFSSVILVSLNILRLLVDETAMPKGSKGSGFGDAS 338

  Fly   390 LSKLGPFGAGLEVCLIFYLGATSVVGFYSMPFMRKVCPKRRQTSLPQLMLNCGFMLVLSSALPLL 454
            |...|..||.||:.|||||..:|||||||:.|.....|::..|::.:::.||..:||||||||::
 Frog   339 LFTFGFAGATLEIILIFYLMVSSVVGFYSLRFFSSFTPRKDDTTMTKVIGNCLSILVLSSALPVM 403

  Fly   455 SRIIGITNFDLLGDFGAIEWLGNFQIVLLYNLVFGTTTALCLANKFTATVRREL 508
            ||.:|||.||||||||...|||||.||:.|||:|...|.|||..|||:.||.||
 Frog   404 SRTLGITRFDLLGDFGRFNWLGNFYIVVAYNLMFAVMTTLCLVRKFTSAVREEL 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
liliNP_651290.1 LMBR1 63..495 CDD:282625 186/436 (43%)
lmbr1NP_001011160.1 LMBR1 18..449 CDD:309779 201/482 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C285789773
eggNOG 1 0.900 E1_KOG3722
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 386 1.000 Inparanoid score I1862
OMA 1 1.010
OrthoDB 1 1.010 D334825at33208
OrthoFinder 1 1.000 FOG0002377
OrthoInspector 1 1.000 T601513
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2924
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.