DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lili and lmbr1l

DIOPT Version :8

Sequence 1:NP_651290.1 Gene:lili / 42956 FlyBaseID:FBgn0027539 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_942575.1 Gene:lmbr1l / 321314 ZFINID:ZDB-GENE-030131-9906 Length:491 Species:Danio rerio

Alignment Length:508 Identity:218/508 - (42%)
Similarity:309/508 - (60%) Gaps:54/508 - (10%)


  Fly     5 EEEEVTDLKLQLFHNTVREHIIFLLLIILLYSSSYVVVSRFRRRDRDDLYSNDEDEVLVYRISFW 69
            |.|:|| ::.|:||:.|||.||.:||.|.||..|:.:::.|::  ..:..::|.::..|.:|:.|
Zfish     2 ETEDVT-VREQIFHDRVRETIICVLLFICLYILSHFILTHFKK--SAEFVTDDIEDATVNKIALW 63

  Fly    70 LCTFTLAVAEGAAMLLPVSIASNEVLLLYPNSYYVKWLNSSLIQGLWNHVFLFSNLSLFIFLPFV 134
            ||||||:||..|.:|||:||.||||||.:|:|||::|||.|||:||||.|||||||||...:||.
Zfish    64 LCTFTLSVAVCAVLLLPISILSNEVLLTFPHSYYMQWLNGSLIRGLWNLVFLFSNLSLVFLMPFA 128

  Fly   135 YLFSESTGFVGNKKGILPRVYETFTVFMLMAIIVLVLTAVLSAVF----GIEKLQFFWFLNLGSV 195
            |.|:||.||.|:|||::.|||||..:.:|::::||.:..|.||:.    ..|.|...|     ..
Zfish   129 YFFTESEGFAGSKKGVMARVYETAVMLLLLSLLVLGIVWVASALLHHNTARESLYDLW-----EY 188

  Fly   196 HLPFLYSCVSFLGVMLMLICTPYGFVRLFGVVNQVLVRPMLLRDVNEEFSAFYMEEASVKRKLAH 260
            :||:|||.:|..||:|:|:|||:|..|:|.|...:||:|.||.::.|..:....||||:.|||..
Zfish   189 YLPYLYSGISLFGVLLLLLCTPFGLSRMFSVTGSLLVKPRLLENLEETMNCAVFEEASLSRKLKS 253

  Fly   261 IELHNVSIADAANGGRLGNRIGLGRGRTFYPQPLLQHSQAHLYQRKAMASDVDELNDRLRELDSE 325
            .....:|                                |||          :.||.....:.|:
Zfish   254 TNTCWIS--------------------------------AHL----------EALNKEFLSVQSK 276

  Fly   326 RKELDKLRTSSTFQRTFVYPLAMLLLLFCTAVTILLVVQNTLELLIGIKALPLSTRQFALGISSL 390
            |..|:..:.:|.:||..|||:||||||..|||::|:|..:.||||....|:|.......||::|.
Zfish   277 RITLELRKRASPWQRNLVYPVAMLLLLALTAVSVLMVCFHVLELLFDESAMPRGMEDPHLGLASF 341

  Fly   391 SKLGPFGAGLEVCLIFYLGATSVVGFYSMPFMRKVCPKRRQTSLPQLMLNCGFMLVLSSALPLLS 455
            |.||..||.::|.:|.||..:|||||||.|....:.|:.:.|:|.|::.||..:|:||||||:.|
Zfish   342 SMLGSLGAAVQVVIILYLMVSSVVGFYSSPLFTGLLPRAQDTTLTQIIGNCVSLLILSSALPVFS 406

  Fly   456 RIIGITNFDLLGDFGAIEWLGNFQIVLLYNLVFGTTTALCLANKFTATVRREL 508
            |.:|||.||||||||..:|||:|.||.|||::|...|:.||.|..|..::|||
Zfish   407 RTLGITKFDLLGDFGRHDWLGSFHIVFLYNMLFAGLTSACLINTVTWALQREL 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
liliNP_651290.1 LMBR1 63..495 CDD:282625 191/435 (44%)
lmbr1lNP_942575.1 LMBR1 25..446 CDD:282625 199/469 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C285798385
eggNOG 1 0.900 E1_KOG3722
Hieranoid 1 1.000
Homologene 1 1.000 H10011
Inparanoid 1 1.050 388 1.000 Inparanoid score I1923
OMA 1 1.010
OrthoDB 1 1.010 D334825at33208
OrthoFinder 1 1.000 FOG0002377
OrthoInspector 1 1.000 T597310
orthoMCL 1 0.900 OOG5_131616
Panther 1 1.100 LDO PTHR12625
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2924
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.