powered by:
Protein Alignment CG6980 and Stip1
DIOPT Version :9
| Sequence 1: | NP_651289.1 |
Gene: | CG6980 / 42955 |
FlyBaseID: | FBgn0039228 |
Length: | 250 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_477354.1 |
Gene: | Stip1 / 33202 |
FlyBaseID: | FBgn0024352 |
Length: | 490 |
Species: | Drosophila melanogaster |
| Alignment Length: | 156 |
Identity: | 48/156 - (30%) |
| Similarity: | 74/156 - (47%) |
Gaps: | 12/156 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 93 DNEKQVKDMNQKSFMEQVE---KDANDRAEARAKAE--------YEAELQRSQGNEAFRSQKYEK 146
:|.||.|...:|:..|... |.:....||:.|.| .:||.::.|||..|:...|..
Fly 264 ENYKQAKVYYEKAMSEHRTPEIKTSLSEVEAKIKEEERMAYINPEKAEEEKEQGNLFFKKGDYST 328
Fly 147 AILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQAHAYKGLK 211
|:.||.:||.:..|....|.|||.||.||..:...||||...: ||.|..::.::.:....:|::
Fly 329 AVKHYTEAIKRNPDDPKLYSNRAACYTKLAAFDLGLKDCDTCI-KLDEKFIKGYIRKGKILQGMQ 392
Fly 212 QDDKFEESVVKAREHNPKQLAYIDKY 237
|..|.:.:..||.|.:|.....|:.|
Fly 393 QQSKAQAAYQKALELDPNNAEAIEGY 418
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0548 |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.