DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and Ttc12

DIOPT Version :8

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_766358.1 Gene:Ttc12 / 235330 MGIID:2444588 Length:704 Species:Mus musculus

Alignment Length:253 Identity:73/254 (29%)
Similarity:125/254 (49%) Gaps:28/254 (11%)


  Fly     1 MANEEVKDNAQLKATMLNCNLNPSVADDFAEFEATLAKIDCILQNKAPCDDEDSKAGGDAKEKIN 65
            ||:::.:|   |:..:.|       .|:.......:...|..:|.||..|.|         :|:.
Mouse     1 MADDQERD---LQRFLEN-------VDEITSLIQEMNSDDPFIQQKAVLDSE---------KKLL 46

  Fly    66 FDNLDVDKVRLKVKENRTVINRKSLEEDNEKQVKDMNQKSFMEQVEKDANDRAEARAKAEYEAEL 130
            ....:.::...:...|:|:|:.....|:.:    :|:..:|:..|||||.:||:.|.:....|:.
Mouse    47 LMEREQEEDGCRTTLNKTMISPPQTPENAD----EMSPDAFLASVEKDAKERAKRRRENRVLADA 107

  Fly   131 QRSQGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQES 195
            .:.:|||||....||.||..|.:.:.|:||..:.|.|||..:|||.:|::||.||.:.| |..|:
Mouse   108 LKEKGNEAFVRGDYETAIFFYSEGLGKLKDMKVLYTNRAQAFIKLGDYQKALVDCDWAL-KCDEN 171

  Fly   196 NLRAWLYQAHAYKGLKQDDKFEESVVKAREHNPKQLAYIDKYIKQL----EADLKALE 249
            ..:|:.:...|:..||...|.:|...|..|.|||..|.:.:::.|:    :|||:..|
Mouse   172 CTKAYFHMGKAHVALKNYSKAKECYQKIEEINPKLKAQVKEHLNQVTLREKADLQEKE 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 27/63 (43%)
TPR repeat 128..156 CDD:276809 11/28 (39%)
TPR repeat 161..192 CDD:276809 14/31 (45%)
TPR_1 162..190 CDD:278916 13/28 (46%)
TPR repeat 197..225 CDD:276809 7/28 (25%)
Ttc12NP_766358.1 TPR_11 105..170 CDD:290150 28/66 (42%)
TPR 1 105..138 14/33 (42%)
TPR repeat 105..133 CDD:276809 11/28 (39%)
TPR repeat 138..168 CDD:276809 14/31 (45%)
TPR 2 139..172 15/34 (44%)
TPR_11 141..204 CDD:290150 24/64 (38%)
TPR_1 142..172 CDD:278916 15/31 (48%)
TPR 3 173..206 11/33 (33%)
TPR repeat 173..198 CDD:276809 6/25 (24%)
TPR_1 174..205 CDD:278916 10/31 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
OrthoInspector 1 1.000 T615305
orthoMCL 1 0.900 OOG5_135663
Panther 1 1.100 LDO PTHR46540
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R218
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.