DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and sti-1

DIOPT Version :8

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_503322.1 Gene:sti-1 / 178587 WormBaseID:WBGene00019983 Length:320 Species:Caenorhabditis elegans

Alignment Length:209 Identity:50/210 (24%)
Similarity:95/210 (45%) Gaps:39/210 (19%)


  Fly    58 GDAKEKINFDNLDVDKVRLKVKENRTVINRKSLEEDNEKQVKDMNQKSFMEQVEKDANDRAEARA 122
            |:|.:|.|..:|.|......:.|.|        :.:..|:||::.::  ::..|:.|....|.  
 Worm    87 GNAFQKQNDLSLAVQWFHRSLSEFR--------DPELVKKVKELEKQ--LKAAERLAYINPEL-- 139

  Fly   123 KAEYEAELQRSQGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQ- 186
                 |:.::::|||.|:...|..|:.||::|:.:..::||.|.|||.|..||..::|||.||. 
 Worm   140 -----AQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDT 199

  Fly   187 -----------YVLEKLQESNLRAWLYQAHAYKGLKQDDKFEE-------SVVKAREHNP---KQ 230
                       |:.:......:|.|.....||:...|.|...|       :.:::.:.:|   |:
 Worm   200 CIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVRNCLRSNDEDPEKAKE 264

  Fly   231 LAYIDKYIKQLEAD 244
            .:..|..::::..|
 Worm   265 RSLADPEVQEILRD 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 25/75 (33%)
TPR repeat 128..156 CDD:276809 10/28 (36%)
TPR repeat 161..192 CDD:276809 15/43 (35%)
TPR_1 162..190 CDD:278916 15/40 (38%)
TPR repeat 197..225 CDD:276809 7/35 (20%)
sti-1NP_503322.1 TPR_11 5..67 CDD:290150
TPR_1 5..38 CDD:278916
TPR repeat 5..33 CDD:276809
BamD 7..172 CDD:276939 24/102 (24%)
TPR repeat 7..34 CDD:276939
TPR_12 35..108 CDD:290160 6/21 (29%)
TPR repeat 38..68 CDD:276809
TPR repeat 44..119 CDD:276939 9/40 (23%)
TPR repeat 80..108 CDD:276809 6/21 (29%)
TPR repeat 132..171 CDD:276939 12/46 (26%)
TPR_11 140..204 CDD:290150 24/64 (38%)
TPR repeat 140..168 CDD:276809 10/28 (36%)
TPR repeat 173..203 CDD:276809 14/30 (47%)
TPR repeat 208..236 CDD:276809 5/28 (18%)
STI1 269..308 CDD:128966 2/11 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.