DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and Y22D7AL.9

DIOPT Version :10

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_497427.2 Gene:Y22D7AL.9 / 175314 WormBaseID:WBGene00021247 Length:836 Species:Caenorhabditis elegans


Alignment Length:77 Identity:19/77 - (24%)
Similarity:36/77 - (46%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 QGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLR 198
            :...|:...:|::|...|:||:.....:.|.:.|.:...:|:|....|||..: :..||.....:
 Worm    11 EAGSAYSDGRYQEARELYEKALRDHPKNGILHANLSAILLKIQLPPEALKHAE-ISVKLCPQWAK 74

  Fly   199 AWLYQAHAYKGL 210
            |:..|..|.:.|
 Worm    75 AYYRQGEAQRAL 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 Spy 117..>233 CDD:443119 19/77 (25%)
TPR repeat 128..156 CDD:276809 6/21 (29%)
TPR repeat 161..192 CDD:276809 7/30 (23%)
TPR repeat 197..225 CDD:276809 4/14 (29%)
Y22D7AL.9NP_497427.2 LapB 18..281 CDD:442196 18/70 (26%)
Spy 19..>104 CDD:443119 18/69 (26%)
TPR repeat 38..68 CDD:276809 7/30 (23%)
TPR repeat 73..96 CDD:276809 4/14 (29%)
LapB 231..480 CDD:442196
HemYx <409..639 CDD:442305
TPR_12 611..684 CDD:315987
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.