DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and Y22D7AL.9

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_497427.2 Gene:Y22D7AL.9 / 175314 WormBaseID:WBGene00021247 Length:836 Species:Caenorhabditis elegans


Alignment Length:77 Identity:19/77 - (24%)
Similarity:36/77 - (46%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 QGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLR 198
            :...|:...:|::|...|:||:.....:.|.:.|.:...:|:|....|||..: :..||.....:
 Worm    11 EAGSAYSDGRYQEARELYEKALRDHPKNGILHANLSAILLKIQLPPEALKHAE-ISVKLCPQWAK 74

  Fly   199 AWLYQAHAYKGL 210
            |:..|..|.:.|
 Worm    75 AYYRQGEAQRAL 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 13/55 (24%)
TPR repeat 128..156 CDD:276809 6/21 (29%)
TPR repeat 161..192 CDD:276809 7/30 (23%)
TPR_1 162..190 CDD:278916 7/27 (26%)
TPR repeat 197..225 CDD:276809 4/14 (29%)
Y22D7AL.9NP_497427.2 PEP_TPR_lipo <9..93 CDD:274350 19/77 (25%)
TPR repeat 38..68 CDD:276809 7/30 (23%)
TPR repeat 73..96 CDD:276809 4/14 (29%)
TPR_12 611..684 CDD:315987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.