DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6980 and Y22D7AL.9

DIOPT Version :9

Sequence 1:	NP_651289.1	Gene:	CG6980 / 42955	FlyBaseID:	FBgn0039228	Length:	250	Species:	Drosophila melanogaster
Sequence 2:	NP_497427.2	Gene:	Y22D7AL.9 / 175314	WormBaseID:	WBGene00021247	Length:	836	Species:	Caenorhabditis elegans

Alignment Length:	77	Identity:	19/77 - (24%)
Similarity:	36/77 - (46%)	Gaps:	1/77 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   134 QGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLR 198
            :...|:...:|::|...|:||:.....:.|.:.|.:...:|:|....|||..: :..||.....:
Worm    11 EAGSAYSDGRYQEARELYEKALRDHPKNGILHANLSAILLKIQLPPEALKHAE-ISVKLCPQWAK 74

  Fly   199 AWLYQAHAYKGL 210
            |:..|..|.:.|
Worm    75 AYYRQGEAQRAL 86

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6980	NP_651289.1	TPR_11	127..190	CDD:290150	13/55 (24%)
		TPR repeat	128..156	CDD:276809	6/21 (29%)
		TPR repeat	161..192	CDD:276809	7/30 (23%)
		TPR_1	162..190	CDD:278916	7/27 (26%)
		TPR repeat	197..225	CDD:276809	4/14 (29%)
Y22D7AL.9	NP_497427.2	PEP_TPR_lipo	<9..93	CDD:274350	19/77 (25%)
		TPR repeat	38..68	CDD:276809	7/30 (23%)
		TPR repeat	73..96	CDD:276809	4/14 (29%)
		TPR_12	611..684	CDD:315987
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0548
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900