DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and TTC9B

DIOPT Version :8

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_016881857.1 Gene:TTC9B / 148014 HGNCID:26395 Length:280 Species:Homo sapiens

Alignment Length:160 Identity:37/161 (23%)
Similarity:61/161 (38%) Gaps:57/161 (35%)


  Fly   113 DANDRAEARAKAEYEAELQRSQGNEAFRSQKYEKAILHYDKAIIKVK------------------ 159
            |::.||....|||         |...:|.:|:.:||..|.:|::::|                  
Human    59 DSSLRAAVAFKAE---------GQRCYREKKFREAIGKYHRALLQLKAAQGARPSGLPAPAPGPT 114

  Fly   160 ----------------DSAITYCNRAL--CYI--KLQNYKRALKDCQYVLEKLQESNLRAWLYQA 204
                            :|....|..:|  |.:  :|.||:|..:.|..|||| |:.|.:|.....
Human   115 SSPGPARLSEEQRRLVESTEVECYDSLTACLLQSELVNYERVREYCLKVLEK-QQGNFKATYRAG 178

  Fly   205 HAY-------KGLK--QDDKFEESVVKARE 225
            .|:       :.|:  |:.:..|..|..||
Human   179 IAFYHLGDYARALRYLQEARSREPTVARRE 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 19/101 (19%)
TPR repeat 128..156 CDD:276809 7/28 (25%)
TPR repeat 161..192 CDD:276809 13/35 (37%)
TPR_1 162..190 CDD:278916 10/32 (31%)
TPR repeat 197..225 CDD:276809 7/37 (19%)
TTC9BXP_016881857.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.