DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and ttc12

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_004916149.1 Gene:ttc12 / 101732246 XenbaseID:XB-GENE-955705 Length:714 Species:Xenopus tropicalis


Alignment Length:245 Identity:73/245 - (29%)
Similarity:119/245 - (48%) Gaps:31/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DDFAEFEATLAKIDCILQNKAPCDD---EDSKAGGDAKEKI--NFDNLDVDKVRLKVKENRTVIN 86
            |:...|...:.:|..|:|:....|:   :::....|.:..:  |.||.|    .::...||||||
 Frog     5 DNLESFLKNIDEITDIIQDLNSSDESHRQEAFLKADKRLALLKNKDNDD----GIRTTANRTVIN 65

  Fly    87 RK--------SLEEDNEKQVKD--MNQKSFMEQVEKDANDRAEARAKAEYEAELQRSQGNEAFRS 141
            ..        |....|    ||  :.|::.:|.:||||.:|||.|.:....|...:..||:||..
 Frog    66 TSPEGMCASGSTYHAN----KDSRLMQENVLEHLEKDAKERAERRKENTAMANALKELGNKAFSK 126

  Fly   142 QKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQAHA 206
            ..||.|:..|.:.:.|::|..:.|.|||..:|||:.|:.|:.|||:.| |..|...:|:::...|
 Frog   127 GDYETAVKCYSEGVEKLRDMQVLYTNRAQAFIKLEKYENAISDCQWAL-KCNEKCAKAYVHMGKA 190

  Fly   207 YKGLKQDDKFEESVVKAREHNPKQLAYIDKYIKQL---EADLK----ALE 249
            |.|||:..:..:..:|..:.:|.....:..||..:   ||:.|    |||
 Frog   191 YLGLKEYSEARKCYLKLLDVDPNLEKLVKDYINTVDLQEANFKQEQVALE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 23/62 (37%)
TPR repeat 128..156 CDD:276809 9/27 (33%)
TPR repeat 161..192 CDD:276809 13/30 (43%)
TPR_1 162..190 CDD:278916 12/27 (44%)
TPR repeat 197..225 CDD:276809 7/27 (26%)
ttc12XP_004916149.1 PLN03088 112..>220 CDD:215568 34/108 (31%)
TPR repeat 113..141 CDD:276809 9/27 (33%)
TPR repeat 146..176 CDD:276809 13/30 (43%)
TPR repeat 181..209 CDD:276809 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm47502
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.