DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ets96B and elk1

Sequence 1:NP_996290.1 Gene:Ets96B FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_696294.3 Gene:elk1 ZFINID:ZDB-GENE-090529-5 Length:521 Species:Danio rerio

Alignment Length:161 Identity:66/162 (41%)
Similarity:95/162 (59%) Gaps:26/162 (16%)


  Fly   491 ISQRRGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSR 555
            ||....|:.|||||:.|||: ......|:||....||||::.|||||.|||:||:..||||||||
Zfish     7 ISAMDPSITLWQFLLHLLDD-QNQKHLISWTSGDGEFKLLDAEEVARLWGLRKNKTNMNYDKLSR 70

  Fly   556 SLRYYYEKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTTGSGK----GDQHQLTLSLAKTPPTS 616
            :|||||:|.|::||:|:::||:||..||.  |.|.|...|...:    |::.:|::   :|.|..
Zfish    71 ALRYYYDKNIIKKVSGQKFVYKFVTYPDP--NSADGLKGTEDSQRASTGEKLELSI---QTKPMG 130

  Fly   617 GDS------------QTQSP----RVAKSEY 631
            |.:            |..||    |.::::|
Zfish   131 GATTANQCLSKSLQVQRSSPSSVQRSSRNDY 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 49/86 (57%)
elk1XP_696294.3 ETS 13..98 CDD:197710 49/86 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.