DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ets96B and Elk3

Sequence 1:NP_996290.1 Gene:Ets96B FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001102213.1 Gene:Elk3 RGDID:1307764 Length:408 Species:Rattus norvegicus

Alignment Length:113 Identity:53/114 (46%)
Similarity:72/114 (63%) Gaps:16/114 (14%)


  Fly   497 SLQLWQFLV-ALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYY 560
            ::.|||||: .|||:......|  ||....||||::.||||:.|||:||:..||||||||:||||
  Rat     4 AITLWQFLLHLLLDQKHEHLIC--WTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYY 66

  Fly   561 YEKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTTGSGKGDQHQLTLS 608
            |:|.|::||.|:::||:||..||.|             |.|.|.:.:|
  Rat    67 YDKNIIKKVIGQKFVYKFVSFPDIL-------------KMDPHAVEIS 101

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 47/87 (54%)
Elk3NP_001102213.1 ETS 5..89 CDD:197710 47/86 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.