DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ets96B and etv5a

Sequence 1:NP_996290.1 Gene:Ets96B FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001119933.1 Gene:etv5a ZFINID:ZDB-GENE-030131-9572 Length:524 Species:Danio rerio

Alignment Length:534 Identity:155/535 (29%)
Similarity:190/535 (36%) Gaps:223/535 (42%)


  Fly   129 PIPPPPPPCCLTLGESSSSP----NPIATAALMNASTSGSSSAGGASASLCNDLTRESSWYAHHH 189
            |:.||..|.         ||    |.:||..|                                 
Zfish   134 PLTPPSTPV---------SPCVPSNALATRPL--------------------------------- 156

  Fly   190 HHHHHHHHQLPDELVMYATPTPTPAIGK---FGLDTSTEGYLNARYNVNVKGVRHDRTSSFFDIP 251
                  |.|.|       .|....|:|:   .|..|.|:.      ..|...|.|...|..|.:|
Zfish   157 ------HEQTP-------PPVSNTALGQRLLHGQPTMTKS------TPNQTCVPHHSQSPPFVVP 202

  Fly   252 A-----VTHPHNHPH-----PHPHPHPHPYCYRFPSSPPAGILKKSDEEATSAAVYCSDVSSGQH 306
            .     .||..|.|.     ..|       |..||.|...|      ..:....|.|:....|:.
Zfish   203 CPPLNRETHFSNEPRFQRQLSEP-------CLPFPPSDAQG------RPSFMPQVACTSPRDGRP 254

  Fly   307 FPHHTKIEHADSTTTAAQQQQQQQ-------EQQQQQQQQQQQQQHQQQLQQ------------- 351
             |:|.::  ::.......|..:|:       ||........|...|...::|             
Zfish   255 -PYHRQM--SEPLVPVPPQGFKQELLDPRYVEQGVPNMGPSQAAFHPMAIKQEPRDFCFDSEVPK 316

  Fly   352 -------AAALHPHHHHSHHGHHGHQQAEQQALTHLTPLHAASAFKFSHTAVISSSAVYATPSHY 409
                   ||:.:.:|.:...      ..|||             ..|..|.|:        |...
Zfish   317 CQSSFGRAASFYQNHENFSF------DREQQ-------------LYFDDTCVV--------PERL 354

  Fly   410 AHQQQTQSQSVYRDLSPTTLAAVSDADLKYDSGPYNAAISSTYPSALRPNVVDSTTSSDAELRLD 474
            ..:.: |..||||                 :..||                              
Zfish   355 EGKVK-QEPSVYR-----------------EGPPY------------------------------ 371

  Fly   475 QFYASNGISTSSNGQAISQRRGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRW 539
                              |||||||||||||.|||:| ::...||||||||||||||||||||||
Zfish   372 ------------------QRRGSLQLWQFLVTLLDDP-SNGHFIAWTGRGMEFKLIEPEEVARRW 417

  Fly   540 GLQKNRPAMNYDKLSRSLRYYYEKGIMQKVN--GERYVYRFVCDPDALFNMAYGHLTTGSGKGDQ 602
            |:||||||||||||||||||||||||||||.  ||||||:|||||:|||:||:......:.|.|.
Zfish   418 GIQKNRPAMNYDKLSRSLRYYYEKGIMQKVKVAGERYVYKFVCDPEALFSMAFPDNQRPNLKADP 482

  Fly   603 HQL------TLSLA 610
            ..|      ||.||
Zfish   483 DGLPTVDDDTLPLA 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 75/88 (85%)
etv5aNP_001119933.1 ETS_PEA3_N 2..375 CDD:309665 67/411 (16%)
ETS 376..462 CDD:197710 74/87 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001228
OrthoInspector 1 1.000 T597003
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11849
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5352
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.