DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ets96B and aop

Sequence 1:NP_996290.1 Gene:Ets96B FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001259908.1 Gene:aop FlyBaseID:FBgn0000097 Length:732 Species:Drosophila melanogaster

Alignment Length:658 Identity:149/659 (23%)
Similarity:219/659 (33%) Gaps:251/659 (38%)


  Fly    12 LIPQSDYGE----AKTHLEQLQQTLTHLDHPHHHHAHHPHHHLGLYHGALPNTSTITTDSVVSCV 72
            |:.::|:|.    |...|..:.|.|....|....|              |||:....|       
  Fly    89 LLTRADFGHRCPGAGDVLHNVLQMLIIESHMMQWH--------------LPNSPVTPT------- 132

  Fly    73 SSTLPAVAKAISASSSCDGLQSERKKCPISDLDSGGHGHGQGHGLMEAICAGQKTSPIPPPPPPC 137
             |..|....:...:.:...|.:..:..|.         |...|.|.........:..:.|||   
  Fly   133 -SRYPLSPHSHPPTPTWPPLNAPPENSPF---------HSSAHSLAGHHFMAPNSVTLSPPP--- 184

  Fly   138 CLTLGESSSSPNPIATAALMNASTSGSS--SAGGASASLCNDLTRESSWYAHHHHHHHHHHHQLP 200
              ::...:|||   ..|...|...:|::  |||| ||......|..|:                 
  Fly   185 --SVDSQASSP---PQAPYQNGGATGAAPGSAGG-SAPAAGGATNTSN----------------- 226

  Fly   201 DELVMYATPTPTPAIGKFGLDTSTEGYLNARYNV-NVKGVRHDRTSSFFDIPAVTHPHNHPHPHP 264
                    ||.:.|        |:.|...::.|: .:||:  ...||           ||.....
  Fly   227 --------PTSSSA--------SSTGSNGSQPNIMPMKGI--SSASS-----------NHSDSEE 262

  Fly   265 H-----------PHPHPYCYRFPSSPPAGILKKSDEEATSAAVYCSDVSSGQHFPHHTKIEHADS 318
            .           | |.|..|...|.|...|||              |:.     |:.|:......
  Fly   263 EYSETSGGVSKMP-PAPLSYSTASPPGTPILK--------------DIK-----PNWTQQLTNSF 307

  Fly   319 TTTAAQQQQQQQEQQ---------QQQQQQQQQQQHQQQLQQAAALHPHHHHSHHGHHGHQQAEQ 374
            ..:.:|||||||:||         |.||.|.||||.||||.|...|                 :.
  Fly   308 VNSWSQQQQQQQQQQAAAVAAVAAQAQQHQLQQQQQQQQLPQKLTL-----------------DN 355

  Fly   375 QALTHLTPLHAASAFKFSHTAVISSSAVYATPSHYAHQQQTQSQSVYRDLSPTTLAAVSDADLKY 439
            .|...:||...:.:                                    :|||.:.:..|..::
  Fly   356 TAGPVVTPAGGSIS------------------------------------APTTPSYMYKAKREF 384

  Fly   440 DSGPYNAAISSTYPSALRPNVVDSTTSSDAELRLDQFYASNGISTSSNGQAISQRRGSLQLWQFL 504
                        :|....||                          :||:.         ||.||
  Fly   385 ------------FPENSEPN--------------------------TNGRL---------LWDFL 402

  Fly   505 VALLDEPTTSAS-CIAWTGR--GMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIM 566
            ..||::.....| .|||..|  |: ||:::|..:|:.||:|||..:|||||:||:|||||...|:
  Fly   403 QQLLNDRNQKYSDLIAWKCRDTGV-FKIVDPAGLAKLWGIQKNHLSMNYDKMSRALRYYYRVNIL 466

  Fly   567 QKVNGERYVYRFVCDPDALFNMAYGHL----TTGSGKGDQHQLTLSLAKTPPT----------SG 617
            :||.|||:.|:|:.:|..|.|:....|    |..:|.|....:....::.|.:          ..
  Fly   467 RKVQGERHCYQFLRNPTELKNIKNISLLRQSTPANGNGGSPSMPQGSSQAPGSPAGQNWNPQQQS 531

  Fly   618 DSQTQSPR 625
            ..|.|||:
  Fly   532 QQQQQSPQ 539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 42/89 (47%)
aopNP_001259908.1 SAM_PNT-Tel_Yan 49..116 CDD:176085 7/27 (26%)
ETS 395..482 CDD:197710 42/97 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11849
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.