DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ets96B and Etv5

Sequence 1:NP_996290.1 Gene:Ets96B FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001100552.1 Gene:Etv5 RGDID:1309590 Length:510 Species:Rattus norvegicus

Alignment Length:495 Identity:155/496 (31%)
Similarity:197/496 (40%) Gaps:153/496 (31%)


  Fly   171 SASLCNDLTR-ESSWYAHHHHHHHHHHHQLPDE-----------LVMYATP---------TPTPA 214
            |..|..||:: :.:|.|         ..|:||:           ||::|.|         :|:..
  Rat    43 SEELFQDLSQLQEAWLA---------EAQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSE 98

  Fly   215 IGKFGLDTSTEGYLNARYNVN--VKGVRHDR--------------------TSSFFDIPAVTHPH 257
            :.    ..|.|..|.|:|...  .....:||                    .:|.|..|..|.|.
  Rat    99 LS----SCSHEQALGAKYGEKCLYNYCAYDRKPPSGFKPLTPPATPLSPTHQNSLFPPPQATLPT 159

  Fly   258 N------------HPHPHPHPHPHPYCYRFPSSPPAGILKKSDEEATSAAVYCSDVSSGQHFPHH 310
            :            .|.|.||..|.|                ..::.|.|.         ...|| 
  Rat   160 SALAPGAGPVQGVGPAPTPHSLPEP----------------GSQQQTFAV---------PRPPH- 198

  Fly   311 TKIEHADSTTTAAQQQQQQQEQQQQQQQQQQQQQHQQQLQQAAALHPHHHHSHHGHHGHQQAEQQ 375
                           |..|..:...:.|...:|:.|:||.:.....|    ...|..|..:...|
  Rat   199 ---------------QPLQMPKMMPESQYPSEQRFQRQLSEPCRPFP----PQSGVPGDTRPSYQ 244

  Fly   376 ALTHLTPLHAA----SAFKFSHTAVISSSAVYATPSHYAHQQQTQSQSVYRDLSPTTLAA----- 431
            .......:.||    ..||..:...:....|...|...||..|          ||..:..     
  Rat   245 RQMSEPVVPAAPPPLQGFKQEYHDPLYEHGVPGMPGPPAHGFQ----------SPMGIKQEPRDY 299

  Fly   432 VSDADLKYDSGPYNAAISSTYPSALRPNVVDSTTSSDAELRLDQFYASNGISTSSNGQAIS---- 492
            .:|:::.....||   :...|.|:   |....|...|..|..|....   :.....|:...    
  Rat   300 CADSEVPNCQSPY---MRGRYFSS---NHEGFTYEKDPRLYFDDTCV---VPERLEGKVKQEPTM 355

  Fly   493 -------QRRGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNY 550
                   |||||||||||||.|||:| .:|..|||||||||||||||||||||||:|||||||||
  Rat   356 YREGPPYQRRGSLQLWQFLVTLLDDP-ANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNY 419

  Fly   551 DKLSRSLRYYYEKGIMQKVNGERYVYRFVCDPDALFNMAY 590
            |||||||||||||||||||.||||||:|||||||||:||:
  Rat   420 DKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAF 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 76/86 (88%)
Etv5NP_001100552.1 ETS_PEA3_N 1..366 CDD:282476 72/400 (18%)
ETS 367..452 CDD:197710 76/86 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001228
OrthoInspector 1 1.000 T618326
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11849
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.960

Return to query results.
Submit another query.