DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ets96B and erg

Sequence 1:NP_996290.1 Gene:Ets96B FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_012812008.1 Gene:erg XenbaseID:XB-GENE-6085047 Length:564 Species:Xenopus tropicalis

Alignment Length:280 Identity:85/281 (30%)
Similarity:124/281 (44%) Gaps:91/281 (32%)


  Fly   361 HSHHGHHGHQQAEQQALTHLTP-------------LHA----ASAFKFSHTAVISSSAVYATPSH 408
            |.|:       ..:..|.|||.             :||    .::|.|.:|              
 Frog   279 HLHY-------LRETPLPHLTSDDVDKALQNSPRLMHARNTGGASFIFPNT-------------- 322

  Fly   409 YAHQQQTQSQSVYRDLSPTTLAAVSDADLKYDSGPYNAAISSTYP---SALRPNVVDSTTSSDAE 470
                      |||:|.|.   ...|..||.|:....:|..:...|   ::..|..|..|  .|..
 Frog   323 ----------SVYQDASQ---RITSRQDLSYEPSRRSAWTNHPAPPTKASQPPATVPKT--EDPR 372

  Fly   471 LRLDQFY----ASNGISTSSNGQAISQRRGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIE 531
            .:||.:.    .|:.::...:||        :||||||:.||.: :::::||.|.|...|||:.:
 Frog   373 PQLDPYQILGPTSSRLANPGSGQ--------IQLWQFLLELLSD-SSNSNCITWEGTNGEFKMTD 428

  Fly   532 PEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTTG 596
            |:|||||||.:|::|.||||||||:|||||:|.||.||:|:||.|:|                  
 Frog   429 PDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF------------------ 475

  Fly   597 SGKGDQHQLTLSLAKTPPTS 616
                |.|.:..:|...||.|
 Frog   476 ----DFHGIAQALQPHPPES 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 48/86 (56%)
ergXP_012812008.1 SAM_PNT-ERG 215..289 CDD:176090 3/17 (18%)
ETS 395..478 CDD:197710 50/114 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.