DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42331 and cd

Sequence 1:NP_001189281.1 Gene:CG42331 FlyBaseID:FBgn0259233 Length:1615 Species:Drosophila melanogaster
Sequence 2:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster

Alignment Length:829 Identity:257/830 (31%)
Similarity:385/830 (46%) Gaps:139/830 (17%)


  Fly     6 LLVALLLLLV---HLENASGKP--------PTKELPRPLIPLHDQDQEEELQPELEAKATFQSTR 59
            :..||.|.||   .|..|.|.|        ...|| .|..||.|:...|.               
  Fly    59 VFTALCLALVFSDSLGGADGGPSFFFVVNGSDSEL-APNRPLPDEPAAEW--------------- 107

  Fly    60 NGRSRRPTLMDVAL-----QQSVRQGLDAMTELYGRIQPEMLRNG-QTLQDNHPAAMLSRFNAPT 118
                   .|...||     .|:|..|:.|:.:      .|:|..| |..:.|.|:  ...:.:.:
  Fly   108 -------ALQQAALGHHDGAQAVSAGIKALGD------REILEEGLQPNEVNTPS--FRHYRSLS 157

  Fly   119 TDSERREMAAYATIAAAKAFRKNFQHIDELARQSHTQRISLRRTALEGLCPPRD----------P 173
            |:.|.|::       |.:.:.:|...||...|.::|::            |.|.          |
  Fly   158 TNPEARKL-------ARRGYVENQATIDIAKRFNYTKQ------------PGRSNIGWGPKIVLP 203

  Fly   174 PPCMPASE-----RYRTHDGTCNNKRRPR-WGAAQMPFNRFLPPEYGDGVDTVRSSADGSTLSSS 232
            .|.:...|     |||...|.||||:.|| :||:.:|:.|.:.|:|.||:...|.|..| .|..:
  Fly   204 DPTVLRLECDFNARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPRVSHHG-RLPPA 267

  Fly   233 RFVSLLVH-GAREGEAPLTLMIAQWGQMLDHDMTSTAQPRSINGSIPSCC--GGKDFHPACFPIK 294
            |.|||.:| .:.|.::..|:|:|.:||.:|||:|:|:...|..|....||  ..::.||.|:|:.
  Fly   268 RQVSLKIHRSSYETDSNFTVMLAVFGQFMDHDITATSLTTSQEGESIDCCVAATREQHPECYPVD 332

  Fly   295 VPLDDPWLAPLKVRCLEFLRSAPAQRRDCVLSWREQTNQVTSYIDASPIYSNSAKSSDNARVFRH 359
            :..|||:.....:.|:.|:|||||....  ...|.|.||.|::||||.:|.|..:..:..|.|.:
  Fly   333 ILPDDPYYKQYNISCMNFVRSAPAPTGR--FGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFIN 395

  Fly   360 GLLVY-----GR------GDPAEDVCQR---GAIATKCIRSGDGRSGEQPGLLAMHHVWVGEHNR 410
            |.|..     ||      .:|| |.|.|   ..:...|..|||.|:.|...|.:||.:|...||.
  Fly   396 GSLRMFVTDDGRQLLPISSNPA-DGCNRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNY 459

  Fly   411 IAMELSELNPHWSDEKVYQETRRIVGAMFQHITFREFLPVILGREVVKLFDLELMPSGYY----E 471
            :|.:|.|.||||.||::|||.|:|:||...|||:.|||||:||:.:.:.  ..|:|:.:.    :
  Fly   460 LARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEA--KGLLPAKHNLNAPD 522

  Fly   472 RYSSKVNPTVANAFAAAAFRFGHSLV--------QNSYTRCDRHHNVINNNVSLHEEFQRGDIGS 528
            .|..:|:|::||.||||||||.|:|:        .||.......|.::.|..||..|.       
  Fly   523 TYDPEVDPSIANCFAAAAFRFAHTLLPGLFNISRDNSTPEAIELHKMLFNPFSLWAEH------- 580

  Fly   529 AGSLHRLLRGLASQRALKRDEFITPELTNHLFQTPG---FPF-GLDLAAINIQRGRDHGIAPYSA 589
             |..|.|:.. |:...::.|.|.:.|:|..||:...   .|. ||||.::||||||||||..|..
  Fly   581 -GIDHALMTA-ANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPV 643

  Fly   590 WRVPCGLSPILSWDDFANVVGPESAKRIGHAYRSVHDIDLFVGGIAERPVVGGLVGPTFACIIAQ 654
            :|..|.|..:.:|::.:..:...:...|...|.|..|:|::.|.::|.|:.|.:.||..:|:::.
  Fly   644 FRRHCRLPTVDTWEEMSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSD 708

  Fly   655 QFSNSRRGDRFWYENGGFESSFTPAQLHSLRRVSLAQVLCRTVGGGT-LQPHIFIPAEFEDNERQ 718
            ||...:.||..|||.......||.|||..:.:.|||.::||...|.| ::.|:........|...
  Fly   709 QFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPHV 773

  Fly   719 TCGVGSLSPIDLSPWLEQDPFHNQQVPEQVFTIGQPELGSVQIIKEDKA 767
            .|........:..||.|      :|.|:.:.:.|... ||..:....||
  Fly   774 DCQDLEGFHFNFEPWSE------KQQPQDLHSAGISR-GSTSVRVMSKA 815

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42331NP_001189281.1 An_peroxidase 183..699 CDD:281139 198/550 (36%)
peroxinectin_like 328..696 CDD:188655 143/398 (36%)
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 199/552 (36%)
peroxinectin_like 364..750 CDD:188655 143/398 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 1 1.000 FOG0000133
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11475
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.