DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and CG16820

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster


Alignment Length:252 Identity:50/252 - (19%)
Similarity:100/252 - (39%) Gaps:39/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TVTAAQELPEGFPKCKRDANFDKCLVDAVNVAIQQLK-AGNREFGIPPLEPLTVKKLVIDAGNAP 84
            :||.:....|..|......:.::|:...:.....:|: .|..||.:..::|...|:.:....|..
  Fly    75 SVTLSSGSNEVTPCSLNSPDLNECIRGLIQSFAPKLRYQGVPEFNMDSIDPYFYKRGIFRYTNDG 139

  Fly    85 INLRQALKNVKVH--DMISTSKIQRYRTDLDKHLIICDSRTDRIEMIGDYEMS---GRILLLPIT 144
            |.....:||::::  ..:..:.:....|| :..:|.......:::..|.::..   |.:.|:|  
  Fly   140 IQGGLLIKNMEIYGISQLQVNSVAANFTD-NGFIIKLGVELPQLKAGGHFKADVKFGGLRLVP-- 201

  Fly   145 GHGKANVTLINTK--------IEHRLIGEPFEKDGVKYMRLKDYR----VSFDPKRVYMNFENLF 197
             .|..|:|:.|.|        ||....|:         .||..:|    |:....:|..|  .:|
  Fly   202 -KGPFNITIDNIKATILTDGHIEQLPSGQ---------QRLSLHRLNANVNIGDAKVVAN--GIF 254

  Fly   198 NDKTLSDGMNRFLNENWETVFNELKVGY---AKSFGIIFRELSNKLFEKVPFDNIFL 251
            :|:.|:..:...:|||...:   .:||.   .:.:..|.....|:.|.|||.:...:
  Fly   255 SDRNLNAMILNLVNENLPEI---TRVGIPATREQWAPILIAHINEFFAKVPIEKFLV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 50/250 (20%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 48/246 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.