DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and CG33306

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_995706.1 Gene:CG33306 / 2768915 FlyBaseID:FBgn0053306 Length:244 Species:Drosophila melanogaster


Alignment Length:239 Identity:52/239 - (21%)
Similarity:91/239 - (38%) Gaps:52/239 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KYSLLLMLLLIAAVAQELTVTAAQELPEGFPKCKRDANFDKCLVDAVNVAIQQLKAGNREFGIPP 67
            |.:.|:.|::..|..|      ..|:.|  |...:..:|...:||.:......|:.|:..||||.
  Fly     2 KSAFLIALIVALASCQ------GAEVAE--PLSAQGRSFSSVIVDGLEAFRVVLQNGSPRFGIPV 58

  Fly    68 LEPLTVKKLVIDAGNAPINLRQALKNVKVHDM----ISTSKIQRYRTDLDKHLIICDSRTDRIEM 128
            :.|:...:...:..:...:....::|.::..:    |.|..:...|:.|..::....     :..
  Fly    59 MAPMKAAQRSFEINSGEFSGTFGVENFELQGLDQYEIITMNMDVIRSRLTFNINFAS-----LNF 118

  Fly   129 IGDYEM---SGRILLLPITGHGKANVTLINTKIEHRLIGEPFEKDGVKY--------MRLKDYRV 182
            ..||||   ||    ..|..:|.|...|.:..|:.|          :.|        :|:||..:
  Fly   119 TTDYEMDMGSG----YRIKRNGGAFFALEDLNIQGR----------ISYSLGVFTSQLRVKDVLI 169

  Fly   183 SFDPKRVYMNFENL-----FNDKTLSDGMNRF----LNENWETV 217
            ......|....|||     ||.| |::.:..|    :|||.:.|
  Fly   170 YPSVGNVNSQIENLSKYRIFNRK-LNEIIEEFVTLTINENTDFV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 49/229 (21%)
CG33306NP_995706.1 JHBP 16..230 CDD:299906 48/225 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.