DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and AgaP_AGAP008182

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_317285.4 Gene:AgaP_AGAP008182 / 1277788 VectorBaseID:AGAP008182 Length:238 Species:Anopheles gambiae


Alignment Length:229 Identity:56/229 - (24%)
Similarity:103/229 - (44%) Gaps:2/229 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LTVTAAQELPEGFPKCKRDA-NFDKCLVDAVNVAIQQLKAGNREFGIPPLEPLTVKKLVIDAGNA 83
            :.|....|||.....|.||: :...|:.:::...:.::.||....|.|.|:|...|...:|....
Mosquito     1 MVVDPEVELPAFMEICYRDSPDLSNCIKNSIQRMLPEMHAGIESLGFPSLDPFLSKSTYVDYKRN 65

  Fly    84 PINLRQALKNVKVHDMISTSKIQRYRTDLDKHL-IICDSRTDRIEMIGDYEMSGRILLLPITGHG 147
            .:.....:||.|.:.|.....:....|..||.: :..|.|...|.|.|.::..||...:.:...|
Mosquito    66 QMAASMHVKNAKTYGMRKAQILDVRATATDKFMNLAVDVRFPEIVMEGYFKGEGRFNSIKLASKG 130

  Fly   148 KANVTLINTKIEHRLIGEPFEKDGVKYMRLKDYRVSFDPKRVYMNFENLFNDKTLSDGMNRFLNE 212
            ..|.|:.:.....::.|...|:||.:|:.::|:.:|.:...:.:....||.|..|:.....|:|:
Mosquito   131 YFNNTMTDVTTTWKMSGHVKERDGEQYLEIEDFDMSPEVGNMKIYATGLFPDPELNQIALEFVNQ 195

  Fly   213 NWETVFNELKVGYAKSFGIIFRELSNKLFEKVPF 246
            .|...:.|:..|..:.:..:..||.||:|.:||:
Mosquito   196 YWPMFYKEMLPGTRQVWEPVMIELVNKIFLRVPY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 56/229 (24%)
AgaP_AGAP008182XP_317285.4 JHBP 2..234 CDD:284096 56/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.