DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and AgaP_AGAP000750

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_311285.2 Gene:AgaP_AGAP000750 / 1272339 VectorBaseID:AGAP000750 Length:272 Species:Anopheles gambiae


Alignment Length:251 Identity:62/251 - (24%)
Similarity:117/251 - (46%) Gaps:14/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLMLLLIAAVAQELTVTAA--QELPEGFPKCKRD-ANFDKCLVDAVNVAIQQLKAGNREF-GIP 66
            |:.:..:::.:|..|...:|  :..||....|:.| .:|..|..::|.....:|..|.... .:.
Mosquito    15 LVRLFWVVSLLALSLPAASASFETKPEFIKTCRFDQPDFVDCSTESVQGLFDKLVTGIEGLEHVG 79

  Fly    67 PLEPLTVKKLVIDAGNAPINLRQALKNVKVHDMISTSKIQRYRTD----LDKHLIICDSRTDRIE 127
            .::|:.:.|:.|..|:.|:::..:|..|.|....||..::...:.    .:.|:     |..::.
Mosquito    80 TIDPMKISKIRILQGDGPVSVNASLSKVVVTGFASTKVLRNVVSSKNFGWETHI-----RLPKMR 139

  Fly   128 MIGDYEMSGRILLLPITGHGKANVTLINTKIEHRLIGEPFEKDGVKYMRLKDYRVSFDPKRVYMN 192
            :.|:|.|.||||::|:.||||.........|..|...:.::|:|..:..:...:|.:....:.::
Mosquito   140 LEGNYHMQGRILVIPLNGHGKCWFEPSGMDIIMRTSTDLYQKNGHVFYNVTGTKVDYTISGLRLH 204

  Fly   193 FENLFND-KTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFD 247
            ..|||.. |.|.|..|::||:||..|...||...||:...|...:...:|.::|.|
Mosquito   205 MGNLFEGVKVLEDSTNQYLNDNWRPVSEALKPIIAKTIEDILLAIMQNIFHQLPAD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 61/244 (25%)
AgaP_AGAP000750XP_311285.2 JHBP 24..263 CDD:284096 61/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.