DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and AgaP_AGAP013061

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_003435987.1 Gene:AgaP_AGAP013061 / 11175689 VectorBaseID:AGAP013061 Length:249 Species:Anopheles gambiae


Alignment Length:258 Identity:70/258 - (27%)
Similarity:115/258 - (44%) Gaps:36/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAAVAQELTVTAAQELPEGFPKCKR-DANFDKCLVDAVNVAIQQLKAGNREFGIPPLEPLTVK 74
            ||:|.|....||.|. :|||....|.| |....:|:.:::......|..|..|..||.::|:.:.
Mosquito     9 LLVALVTLGATVDAV-DLPEYLHVCHREDPKLTECMKESIETLRPYLARGIPELDIPSIDPIHLG 72

  Fly    75 KLVIDAGNAPINLRQALKNVKVH----------DMISTSKIQRYRTDLDKHLIICDSRTDRIEMI 129
            .|::........:..:.|::|.:          ::|...||..:..:| .||.:          .
Mosquito    73 DLIVAESVPGQGVSISAKDIKAYGPSNFKLKKLNVIEYGKIYSFELEL-PHLYV----------E 126

  Fly   130 GDYEMSGRILLLPITGHGK--ANVT----LINTKIEHRLIGEPFEKDGVKYMRLKDYRVSFDPKR 188
            |.|.:.|||||||:.|.||  .|.|    .:..|.:.:.|.   .||.:...:| |.::.....|
Mosquito   127 GRYVVDGRILLLPVKGSGKFTGNFTQGIGSVRIKGDRKRIN---GKDHLSLAKL-DIKIRVSDGR 187

  Fly   189 VYMNFENLF-NDKTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFDNIF 250
            |  ..|||| .|:.|.:.:|..:|:|:..:..||.....|:...||:...||:.|:.|.:.:|
Mosquito   188 V--KLENLFGGDRVLGEIINETINQNFNLLSTELIPLIEKALQRIFKRTGNKILERFPEEVLF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 68/256 (27%)
AgaP_AGAP013061XP_003435987.1 JHBP 9..249 CDD:284096 70/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.