DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13617 and dzip1l

Sequence 1:NP_001262918.1 Gene:CG13617 FlyBaseID:FBgn0039201 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_012826036.1 Gene:dzip1l XenbaseID:XB-GENE-991168 Length:798 Species:Xenopus tropicalis

Alignment Length:747 Identity:155/748 (21%)
Similarity:281/748 (38%) Gaps:229/748 (31%)


  Fly    16 FKLRQYRDGPLDWRLMGSYETERILREQNFELVDKALTHLS------------EAPLGTVLETHI 68
            |:.:..||| :|||...:.:||||.||.:...:.:::..::            :.|:..||    
 Frog    51 FRFQPRRDG-IDWRRFSAIDTERITREVDINTLQESINSITFCNLEGEKCPYCQQPVDPVL---- 110

  Fly    69 LDSGIAKYFVMSQYAIQYLMCCRTY-------LDECVTDLKEAHTTAQEEIATLRKSLSESNNEV 126
                 .|...|:|..|:||:.|:.:       |:|.:.:.:..|...::|:|...:.:.:...|.
 Frog   111 -----LKVLKMAQMIIEYLLYCQEHIHSREAQLEERLGEAEAEHERTKDELAKQAEEMKKVKEES 170

  Fly   127 VQLHKRI-TQ---IEAIREVVYPCHLCTKNFISNEALNVHIGRKHRVASPPSLTSATGKEKDRDK 187
            .:..|.| ||   ::|.....:.|.||.|.|::...|..||.|:|     |.:|     |.:|.|
 Frog   171 KRRKKMIATQQMLLQAGANNYHKCQLCDKAFMNYSYLQGHIQRRH-----PEIT-----EIERQK 225

  Fly   188 ATDVHLINTIKMELEIKQLKERLNAAERNIKERSTGSKRVSPRQEQRHVGIQSNLAEPKEKDEDS 252
            ...|.     :||..|::||.:|...:..::|          .:|..|          |::.:::
 Frog   226 KKQVE-----QMEDGIEELKSKLLKTQAILEE----------EREMEH----------KKRLQEA 265

  Fly   253 GEARQSEASERKEQLTGLAERLSNFEEW--------QTQLKQSNEQF---IQDI---NKRLEGLS 303
            .|||..|.:.:::           ||.|        |.::.:..:||   :|::   |...|...
 Frog   266 EEARHREETLKRD-----------FERWREEERSKRQDEMDKIMQQFHSQLQEVTLKNSTYESRF 319

  Fly   304 HALEQSKQASASTPPLEDRVATPCLEDLERILTEKVAEIGKVSAHRLEEVVYHLEEGYKEKLGAL 368
            |.||.......|...|.|        :.||:..:::.:    ....|:|.:...:.|:|:||..:
 Frog   320 HNLESKNSMVPSLGNLAD--------EEERLELKRLQQ----GMRNLKEELEQQQSGWKKKLKEV 372

  Fly   369 ERELKQLSVQKVQPEPVQTVPVASKIPKPVVRKEETNIDRIRKQVESEFLKQKHDDDTYSIEEAP 433
            :|:                         ..|.|:|.       |.|:|.||.....|..::::  
 Frog   373 QRD-------------------------HGVEKQEL-------QYENERLKASMTRDQQAVDQ-- 403

  Fly   434 RKGSEKPFPQLVTQVQVVEKEQPSAGSSDSNPTYTKSPREPAPNKQETKEATDV---SDSLSQEE 495
                     |:..|:|.::.:.........|...|   .|.....:|..:...|   :.::..|.
 Frog   404 ---------QVTKQMQSLKSQIKEKNKLIQNYELT---IEDLSRSREVPQVAQVVLPAGAIKDEA 456

  Fly   496 TENEEERSLTEEEGTDVPTSGSEAAREDPTPKTIKPSGRIIKSPQKPLTRKDARKMVNRKLMSHG 560
            :|:|.:.||::...|      .:..|.:|.         .||.     .|....:.:..||.|.|
 Frog   457 SEDELDYSLSQNLKT------IDDLRRNPD---------FIKQ-----FRPILEQTLIEKLESLG 501

  Fly   561 FDMKSKGISHNSLKRVNSEL-TEHRNKLKLQHPHFYATRNRIRKFVEKLCSAKFSERAEMLLKHK 624
            ....:|||:.::.|.:.:.| |:...|:: :||.....|   .|.|:||                
 Frog   502 VKKGAKGINSSAHKNLIAVLQTQLEQKIR-KHPEIQTIR---AKMVKKL---------------- 546

  Fly   625 SPLKPMEVPGKGIPRSAISEKSEEDIASSQGEEQTDEQTDSSEQQTRSPSPQRLV----SRDFKA 685
                                  .:.:...|..|:|: |..||:..::.||.||:|    ....:|
 Frog   547 ----------------------TQKVKQWQKNEETN-QYKSSQLSSQKPSNQRIVPPSEEETSQA 588

  Fly   686 RLEEILVKPAATIRGASKSSLSSRPVPLPRKR 717
            |...:|:.       .|:.|.:..|||.||.:
 Frog   589 RSRNVLMV-------GSQQSPNRAPVPFPRTK 613

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13617NP_001262918.1 Dzip-like_N 16..133 CDD:290529 30/136 (22%)
dzip1lXP_012826036.1 Dzip-like_N 51..171 CDD:290529 29/130 (22%)
SbcC <128..>563 CDD:223496 115/602 (19%)
C2H2 Zn finger 194..215 CDD:275368 9/21 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IYV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002370
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.