DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13617 and dzip1

Sequence 1:NP_001262918.1 Gene:CG13617 FlyBaseID:FBgn0039201 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001073034.1 Gene:dzip1 XenbaseID:XB-GENE-997055 Length:858 Species:Xenopus tropicalis

Alignment Length:765 Identity:157/766 (20%)
Similarity:300/766 (39%) Gaps:200/766 (26%)


  Fly    14 TGFKLRQYRDGPLDWRLMGSYETERILREQNF-------------ELVDKALTHLSEAPLGTVLE 65
            |.||.|. |...:|||.:|:.:.|::..|.:|             .|.|:...|...:       
 Frog    42 TMFKFRT-RHESMDWRRIGAIDVEKVANELDFITLQENVMSITFCNLQDEKCPHCKNS------- 98

  Fly    66 THILDSGIAKYFVMSQYAIQYLMCCRTYLDECVTDLKEAHTTAQEEIATLRKSLSESNNEVVQLH 130
               ||..:.|.|.:||:.|:||:..:.||...:..::|....|.:|...::..:::.:.::..|.
 Frog    99 ---LDPILLKLFRLSQFTIEYLLHSQEYLTSSLRSMEEEAQAAIKEAEQIKLKMAKQSEDIKSLK 160

  Fly   131 ---KRITQIEAIREVV--------YPCHLCTKNFISNEALNVHIGRKHRVASPPSLTSATGKEKD 184
               ||..::.|.::::        :.|:.|.|.|::...|..||.|:|    |.|..|    ||.
 Frog   161 DECKRRKKMIASQQMMISAGAGAYHKCNFCDKAFVNYSFLQSHIHRRH----PQSAES----EKT 217

  Fly   185 RDKATDVHLINTIKMELEIKQLKERLNAAERNIK-ERSTGSKRVSPRQEQRHVGIQSNLAEPKEK 248
            :.:|.::       ::.||.:||..|...:..:: ||....:::|..||.               
 Frog   218 KQQANEL-------LQNEISKLKNELQHTKCQLETERCAQIEKLSKFQEM--------------- 260

  Fly   249 DEDSGEARQSEASERKEQLTGLAERLSNFEEWQTQLKQSNEQFIQDIN----KRLEGLSHALEQS 309
                      :..:..||     |.|..|..|:.:.|:.:.:.|..:|    |.|:.|:     .
 Frog   261 ----------DCQKSFEQ-----EMLKKFNSWKEEEKEKHCEEIAKVNDMFRKDLQDLA-----M 305

  Fly   310 KQASASTPPLEDRVATPCLEDLERILTEKVAE---IGKVSAHRLEEVVYHLEEGYKEKLGALERE 371
            |.||              ||.|..:..:|..|   :.|.::.:.||...|:||..|.| ...:::
 Frog   306 KNAS--------------LEKLHEMEQQKTFEQEMLKKFNSWKNEEKEKHVEEMVKVK-DMFQKD 355

  Fly   372 LKQLSVQKVQPEPVQTVPVASKIPKPVVRK--EETNIDRIRKQVESEFLKQKHDDDTYSIEEAPR 434
            |.:|:::         :.|..:..:...||  |:..:.:.....|.|  |:||.::...:::..:
 Frog   356 LNELTMK---------IAVLERFHETGHRKSFEQEMLKKFNSWKEEE--KEKHAEEIAKVKDKLQ 409

  Fly   435 KGSEKPFPQLVTQVQVVE------KEQPSAGSSDSNPTYTKSPREPAP--NKQETKEATDVSDSL 491
            |.        ||::.|..      ||| |...:....||::..:.|.|  :..|.|....:...:
 Frog   410 KE--------VTELAVKNASLGKVKEQ-SIKLTPPVATYSEIVQAPTPLSHHSEIKPNASLLSDV 465

  Fly   492 SQEETENEEERSLTEEEGTDVPTSGSEAAREDPTPKTIKPSGRIIKSPQKPLTRKDARKMVNRKL 556
            ..|....::..:||:.:.               ..|.::|.               ..:.:..||
 Frog   466 EAEVPSLQKTHALTKNQS---------------LAKELRPV---------------FEEGLAEKL 500

  Fly   557 MSHGFDMKSKGISHNSLKRVNSELTEHRNKLKLQHPHFYATRNRIRKFVEKLCSAKFSERAEMLL 621
            .|.|....::||..:..|::...:..:|.:.:.|.|.:       |:..:.|.|       :::|
 Frog   501 ESLGVKQGARGIPSDQCKKMLDSVKCYRAEREKQMPAY-------RQIRQNLIS-------DLIL 551

  Fly   622 KHKSPLKPM--------EVPGKGIPRSAISEKSEEDI-ASSQGEEQTDEQTDSSEQQTRSPSPQR 677
            |.:....|.        :...||...|.:..|||..: .|||....:|:::.:|.:||:: ..:.
 Frog   552 KAEERTSPTVGKLGSTPQALRKGSISSFLHPKSEASVLKSSQESYLSDQKSFASLKQTKA-KVKV 615

  Fly   678 LVSRDFKARLEEILVKPAATIRGASKSSLSSRPVPLPRKRVMFNTTEDGK 727
            ::|:|..|:....:..|..|  ...:||....|:      :..|||:..|
 Frog   616 VLSKDMSAKKPPCVKTPPFT--SDDESSADGGPM------LTCNTTDSLK 657

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13617NP_001262918.1 Dzip-like_N 16..133 CDD:290529 31/133 (23%)
dzip1NP_001073034.1 Dzip-like_N 44..164 CDD:290529 29/131 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IYV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002370
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.