DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13617 and Dzip1l

Sequence 1:NP_001262918.1 Gene:CG13617 FlyBaseID:FBgn0039201 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_006511535.1 Gene:Dzip1l MGIID:1919757 Length:800 Species:Mus musculus

Alignment Length:760 Identity:157/761 (21%)
Similarity:290/761 (38%) Gaps:207/761 (27%)


  Fly     6 KYPQMVRE------------TGFKLRQYRDGPLDWRLMGSYETERILREQNFELVDKALTHLSEA 58
            :||....|            ..||.:..|:. :|||.:.:.:.:|:.||.:...:.:.:..::..
Mouse    28 QYPAATAEGLSGPLSGAYTLPAFKFQPRRES-IDWRRISAVDVDRVARELDVATLQENIAGVTFC 91

  Fly    59 PLGTVLETHI---LDSGIAKYFVMSQYAIQYLMCCRTYLDECVTDLKEAHTTAQEEIATLRKSLS 120
            .|...:..|.   :|..:.|...::|..|:||:.|:..|...|..|:          |.|:.||.
Mouse    92 NLDGEVCNHCRQPVDPVLLKVLRLAQLIIEYLLHCQDCLSASVAQLE----------ARLQASLG 146

  Fly   121 ESNNEVVQLHKRITQIEAIRE----------------------VVYPCHLCTKNFISNEALNVHI 163
            :......:|.::..:::.:||                      ..:.||||.|.|::...|..||
Mouse   147 QQQRGQQELGRQADELKGVREESRRRRKMISTLQQLLLQTSAHSYHTCHLCDKTFMNATFLRGHI 211

  Fly   164 GRKHRVASPPSLTSATGKEKDRDKATDV--HLINTIKM---ELEI-------KQLKERLNAAERN 216
            .|:|      :..:..||:|......:|  .|...:|.   |||.       :|::|...|.:|.
Mouse   212 QRRH------AGMADVGKQKQEQPLGEVLEELRAKLKWTQGELEAQREAERQRQVQELEMARQRE 270

  Fly   217 I-----------KERSTGSKRVSPRQ-----EQRHVGIQSNLAEPKEK--------DEDSGEARQ 257
            :           ||||.....:...:     |.:.|..|::..|.|.|        :...|..|.
Mouse   271 MEAKKKFDEWKEKERSKLYGEIDKLKQLFWDEFKTVANQNSTLEEKLKALQSYSMTESHLGSLRD 335

  Fly   258 SEASER---KEQLTGLAERLS-NFEEWQTQLKQSNEQ------FIQDINKRLEGLSHALEQSKQA 312
            .|:.||   .:::..|.|::. ...||:.::|..:|:      .:|:.|:||. :|.:.:|.|.|
Mouse   336 EESEERLKHAQEVQALQEKMEVQKTEWKRKMKALHEERAAERRQLQEENERLH-VSLSQDQKKAA 399

  Fly   313 SASTPPL-----------------EDRVATPCL---------------------EDLERILTEKV 339
            :.|...:                 |:.:.|..|                     |:||..|.|:.
Mouse   400 AQSQRHINALRAQLQEQARLIESQEETIQTLSLRKVEEVQEMPKAVATEEDSSEEELEASLEERQ 464

  Fly   340 AEIGKVSAHR-----LEEVVYHLEEGYKEKLGAL--ERELKQLSVQKVQP-EPV---QTVPVASK 393
            .:...::|.|     |::....||:..:|||..|  :|:.|.:|.|.|:. ||:   |...:|..
Mouse   465 EQRKVLAALRKNPTWLKQFRPILEDTLEEKLEGLGIKRDTKGISAQTVRRLEPLLRTQREQIARS 529

  Fly   394 IPK-PVVRKEETNIDRIRKQVESEFLKQKHDDDTYSIEEAPRKGSE--------KPFPQLVTQVQ 449
            ..: |.:|      :::.|:|.|. :||:.:..|....:.|.|...        :|..:.:|...
Mouse   530 FREFPSLR------EKLNKEVSSR-VKQRWESTTQPDGQPPVKSQRVTLATREVRPKTRTLTVAL 587

  Fly   450 VVEKEQPSA----GSSDSNPTYTK------SPREPAPNKQETKEATDVSDS---LSQEETENEEE 501
            ..:..:||.    |.|...|..|:      .||...|:.......:.:|.:   .|:||.|.:..
Mouse   588 PSKPAEPSTPTLQGHSSHGPGLTQVSTPIPRPRVHGPSSTPVSPGSGLSSTPPFSSEEEPEGDVV 652

  Fly   502 RSLTEEEGTDVPTSG-----------SEAAREDPTPK-----TIKPSGRIIKSPQKPLTRK---D 547
            :.::.:....:|.|.           ||.:.|...|.     .:..||.:::|..|.|.::   .
Mouse   653 QRVSLQPPKVLPRSAAKPEDNWGWSDSETSEESAQPPGKGSGGLASSGTLVQSIVKNLEKQLETP 717

  Fly   548 ARKMVNRKLMSHGFDM---KSKGISHNSLKRVNSELTEHRNKLKL 589
            |:|      .|.|.:|   .:..:...|.....|:|:|..:.:::
Mouse   718 AKK------PSGGVNMFLRPNAALQRASTPARKSQLSEDESDVEI 756

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13617NP_001262918.1 Dzip-like_N 16..133 CDD:290529 26/120 (22%)
Dzip1lXP_006511535.1 Dzip-like_N 50..170 CDD:290529 28/131 (21%)
GBP_C <336..428 CDD:303769 19/93 (20%)
coiled coil 387..408 CDD:293879 6/22 (27%)
coiled coil 417..428 CDD:293879 1/11 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IYV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5351
Isobase 1 0.950 0 Normalized mean entropy S8157
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002370
OrthoInspector 1 1.000 T1083904
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21502
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5355
TreeFam 1 0.960
87.990

Return to query results.
Submit another query.