DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13617 and Dzip1

Sequence 1:NP_001262918.1 Gene:CG13617 FlyBaseID:FBgn0039201 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_080219.2 Gene:Dzip1 MGIID:1914311 Length:852 Species:Mus musculus

Alignment Length:823 Identity:161/824 (20%)
Similarity:275/824 (33%) Gaps:253/824 (31%)


  Fly    24 GPL------------DWRLMGSYETERI--------LREQNF-----ELVDKALTHLSEAPLGTV 63
            |||            |||.:.:.:.:::        |:|...     :|.|:...|....     
Mouse    38 GPLPFFQFRPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSG----- 97

  Fly    64 LETHILDSGIAKYFVMSQYAIQYLMCCRTYLDECVTDLKEAHTTAQEEIATLRKSLSESNNEVVQ 128
                 :|..:.|...::|..|:|||..:.:|...:..::|          .||.||.:.......
Mouse    98 -----VDPVLLKLIRLAQLTIEYLMHSQEFLTSQLNLVEE----------RLRLSLLDYEQSKQL 147

  Fly   129 LHKRITQIEAIRE--------------------VVYPCHLCTKNFISNEALNVHIGRKHRVASPP 173
            |.|:..:|:.::|                    ..|.||.|.|.|::...|..||.|:|      
Mouse   148 LTKQAGEIKLLKEECKRRKKMLSTQQLMIEAKASYYQCHFCDKAFMNQAFLQSHIQRRH------ 206

  Fly   174 SLTSATGKEKDRDKATDVHL-----INTIKMELEIKQLKERLNAAERNIKERSTGSKRVSPRQEQ 233
                          ..|.||     ..|.:::.||..|||:|......::.          .|..
Mouse   207 --------------TEDSHLEYNTKAQTDRLQKEIDMLKEQLQLTRSQLES----------AQHS 247

  Fly   234 RHVGIQSNLAEPKEKDEDSGEARQSEASERKEQLTGLAERLSNFEEWQTQLKQSNEQFIQDINKR 298
            ..|....:....|.|:||..:.......|.||:|....|::..             .|:::. |.
Mouse   248 HAVRFSKDYEMQKSKEEDFLKLFDRWKEEEKEKLLEEMEKVKG-------------MFMREF-KE 298

  Fly   299 LEGLSHALE-QSKQASASTPPLEDRVAT------------PCLEDLERILTEKVAEIGKVSAHRL 350
            |...:.||| |..:...|...::..:.|            ||.:|.:.:|     ::....|.:.
Mouse   299 LTSKNSALEYQLLEIQKSNIQIKSNIGTLRDVTELREDHLPCPQDFQNML-----QLLDSQASKW 358

  Fly   351 EEVVYHLEEGYKEKLGALERELKQLSVQKVQPEPVQTVPVASKIPKPVVRKEETNIDRIRKQVES 415
            .:....|.|.:.::.|.|      ||                            :|:::|    |
Mouse   359 TDRFQVLNEEHSKEKGQL------LS----------------------------HIEKLR----S 385

  Fly   416 EFLKQKHDDDTY---SIEEAPRKGSEKPFPQLVTQVQVVEK--EQPSAGSSDSNPT----YTKSP 471
            ..:|....|:.:   .:||..:|..|:. ..:::|.|.:.:  .:|.:..|:...|    .|..|
Mouse   386 SMMKDLSADNVFYKRRVEELGQKLQEQN-ELIISQKQQIREFASKPYSSISELKGTPLTRQTLEP 449

  Fly   472 REPAPNKQETKEATDVSDSLSQ-----------------EETENEEERSLTEEEGTDVPTSGSEA 519
            :..||....|..||...|..|.                 ||..:|||:....|:..:..||..:.
Mouse   450 KSAAPTTPMTASATQNLDGASSLTMVHEQVFSSHILEPIEELSSEEEKGRENEQKLNKKTSLRKP 514

  Fly   520 AREDPTPKTIKPSGRIIKSPQKPLTRKDARKMVNRKLMSHGFDMKSKGISHNSLKRVNSELTEHR 584
            :...|:|:.:               |.:..:.:..||.|.|.....:||....|.|....:...|
Mouse   515 SSTSPSPQEL---------------RTNLERELGNKLRSFGIGANIQGIPCEILNRSLKAMQVAR 564

  Fly   585 NKLKLQHPHFYATRNRIRKFVEKLCSAKFSERAEMLL-KHKSPL----------KPMEVPGKGIP 638
            :.|..|.|..    .:||:.:|.....|..|:..:.. :|..|.          |..::|.|..|
Mouse   565 HDLAKQMPDI----QQIRESLEHQLICKMEEKVSLSSDRHHVPSMTTFPPEEVPKATQLPHKSRP 625

  Fly   639 ----RSAISEKSEEDIASSQGEE--------QTDEQTDSSEQQTRSPSPQRLVSRDFKARLEEIL 691
                |:..::|..........:|        .|.....|||::   |..:.|:    .|.|....
Mouse   626 LVRQRTVFTDKVSVPKLKKNTKESHFLRRFPSTKTPPFSSEEE---PDEEDLL----HAYLSPDS 683

  Fly   692 VKPAATIRGASKSSLSSRPVPLPRKRVMFNTT-EDGKSFNDSD 733
            :..|||  ...|||:|.    ..:..|..:|. .:|...:|||
Mouse   684 LATAAT--QPPKSSMSH----FGKSAVKSDTDWTEGSEMDDSD 720

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13617NP_001262918.1 Dzip-like_N 16..133 CDD:290529 26/134 (19%)
Dzip1NP_080219.2 Dzip-like_N 43..163 CDD:290529 25/140 (18%)
zf-C2H2 183..206 CDD:278523 10/23 (43%)
C2H2 Zn finger 185..206 CDD:275368 9/21 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IYV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5351
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002370
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_135146
Panther 1 1.100 LDO PTHR21502
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5355
TreeFam 1 0.960
76.940

Return to query results.
Submit another query.