DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13617 and dzip1l

Sequence 1:NP_001262918.1 Gene:CG13617 FlyBaseID:FBgn0039201 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001032304.1 Gene:dzip1l ZFINID:ZDB-GENE-051113-196 Length:756 Species:Danio rerio

Alignment Length:840 Identity:183/841 (22%)
Similarity:315/841 (37%) Gaps:259/841 (31%)


  Fly    16 FKLRQYRDGPLDWRLMGSYETERILREQNFELVDKALTHLSEAPL---------GTVLETHILDS 71
            |:.|. |..|:|||.:.:.:.:|:.|:.:..::...:..::...|         |.|      |.
Zfish    30 FRFRS-RTEPIDWRRLSTLDVDRVARDMDVSVLQDFIMTVTFCALEGERCPNCRGPV------DP 87

  Fly    72 GIAKYFVMSQYAIQYLMCCRTYLDECVTDLKE----AHTTAQE---EIATLRKSLSESNNEVVQL 129
            .:.|...|||.:.:||:.|:.:|...:..|:|    |.:..|:   :.|.|.|||.|:..|    
Zfish    88 SLVKLLRMSQLSTEYLLQCQDFLSSQLAGLEERLQAATSLVQQGEGQRAELEKSLQETKQE---- 148

  Fly   130 HKRITQIEAIREVV--------YPCHLCTKNFISNEALNVHIGRKHRVASPPSLTSATGKEKDRD 186
            ::|..|:.|.::::        :.|..|.|:|::...|..|:.|:|     |.:|.|   ||.:.
Zfish   149 NRRRKQLIATQQLLLQASANNYHKCQFCEKSFVNYSYLQAHVQRRH-----PEVTDA---EKQKK 205

  Fly   187 KATDVHLINTIKMELEIKQLKERLNAAERNIKE--RSTGSKRVSPRQEQRHVGIQSNLAEPKEKD 249
            :..:       :||..|::|||:|...:..::|  ::...:|...:::||.          :|:.
Zfish   206 RKVE-------EMEDGIEELKEKLRLTQMQLQEEQQADNLRRQQEQEQQRR----------REQS 253

  Fly   250 EDSGEARQSEASERK--EQLTGLAER-LSNFEEWQTQLKQSNEQFIQDINKRLEGLSHA-LEQSK 310
            |.....|..|...||  :::..|.:. |...:|..::......:.:...||.:.|.::| |:|. 
Zfish   254 EKEALERWKEDERRKFNQEIADLRQLFLQESKEMASKSSSIEAKLLVLQNKEMAGFNNASLQQD- 317

  Fly   311 QASASTPPLEDRVATPCLEDLERILTEKVAEIGKVSAHRLEEVVYHLEEGYKEKLGALERELKQL 375
                |.|..|.|      |:.||.|.|::|........:.:|.....::..||......|.||.|
Zfish   318 ----SDPEKEMR------ENRERELRERIARKKSEWRRKFQEAQKRHQQENKELKSENSRLLKAL 372

  Fly   376 SVQK-----VQPEPVQTVPVASKIPKPVVRKEETNIDRIRKQVESEFLKQKHDDDTYSIEEAPRK 435
            ||:|     ||....|.|.::|::.:.         ||:.|                |.||..:|
Zfish   373 SVEKNSTSSVQKLQQQVVSLSSQLSQK---------DRLIK----------------SQEEKIKK 412

  Fly   436 GSEKPFPQLVTQV-------QVVEKEQPSAGSSDSNPTYTKSP----------REPAPNKQETKE 483
            .|..|.|..|..:       :.||:::.|  ..||:....|:|          ||..|..:|:.|
Zfish   413 LSATPVPVSVVSLNDQDSSEEPVEQDRDS--QEDSDEPQWKAPKIRKGKPALMRESKPILEESLE 475

  Fly   484 ---------------ATDVSDSLS-----------QEETENEEER-SLTEEEGTDVPTSGSEAAR 521
                           :.....|||           :::|..:..| |||.|....|.:....:.:
Zfish   476 QKLENMGLRKGTKGISKQTFKSLSSLLAGQRLQKFRQQTNLQSLRDSLTLEVTRRVKSLQKSSGK 540

  Fly   522 EDPTPKTIKPSGRIIKSPQKPLTRKDARKMVNRKLMSHGFDMKSKGISHNSLKRVNSELTEHRNK 586
              |||.|:|..|   |....||..|..|                        .|.:|:.::.|.|
Zfish   541 --PTPNTLKQRG---KKTSTPLNEKSLR------------------------FRQDSKASDRREK 576

  Fly   587 LKLQHPHFYATRNRIRKFVEKLCSAKFSERAEMLL-----KHKSPLKPMEVP-----GKGIPRSA 641
                                       |::.:.||     :.|:| .|.:.|     ....|..:
Zfish   577 ---------------------------SQQPKTLLPTPTPRSKAP-PPNQTPKILAKKNSTPPFS 613

  Fly   642 ISEKSEED---IASSQGEEQTD----------------EQTDSSEQQT-------RSPSPQRLVS 680
            ..|:|.||   |.||:|...:.                :.|||...:.       ::.:||..|.
Zfish   614 SDEESVEDTAYITSSRGNLSSSVRVVQSGSLLNPTTEPDWTDSELSEDLDLPKIYKTCNPQGSVV 678

  Fly   681 RDFKARLEEILVKPAATIRGASK----SSLSSRPVPLPRKRVMFNTTEDGKSFNDSDDNL 736
            :.....||..|..|..|..|.::    ||.:.||..:.::.:         |..:||..|
Zfish   679 QTLTRSLERQLSTPIKTPVGGTRVLPPSSTTPRPAIVKQQAL---------SGEESDSEL 729

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13617NP_001262918.1 Dzip-like_N 16..133 CDD:290529 33/133 (25%)
dzip1lNP_001032304.1 Dzip-like_N 30..150 CDD:290529 32/131 (24%)
zf-C2H2 171..194 CDD:278523 7/23 (30%)
C2H2 Zn finger 173..194 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IYV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I4996
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002370
OrthoInspector 1 1.000 T1053112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21502
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5355
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.