DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13617 and dzip1

Sequence 1:NP_001262918.1 Gene:CG13617 FlyBaseID:FBgn0039201 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_005165761.1 Gene:dzip1 ZFINID:ZDB-GENE-040526-1 Length:907 Species:Danio rerio

Alignment Length:826 Identity:180/827 (22%)
Similarity:332/827 (40%) Gaps:215/827 (26%)


  Fly    16 FKLRQYRDGPLDWRLMGSYETERILREQNFELVDK---ALT---------HLSEAPLGTVLETHI 68
            :|.|..|:. :|||.:.:.:.:|:..|.:|:.:.:   |:|         |..::|         
Zfish    65 YKFRSRREN-VDWRRINAVDVDRVACEMDFQALQEHINAVTFCSVEGERCHRCQSP--------- 119

  Fly    69 LDSGIAKYFVMSQYAIQYLMCCRTYLDECVTDLKEAHTTAQEEIATLRKSLSESNNE---VVQLH 130
            :|..:.|.|.::|..::||:    :..:|::...:|   |:|.:      |:|:...   .|||.
Zfish   120 VDPALIKLFRLAQLTVEYLL----HSQDCLSISLQA---AEERL------LAEAREREQICVQLQ 171

  Fly   131 KRITQIEAIREVV----------------------YPCHLCTKNFISNEALNVHIGRKHRVASPP 173
            |:....:|::|.:                      :.|..|.|.|::...|..|:.|:|     |
Zfish   172 KKTQDAKALKEELKQRKKIIASQQAMFSAGISANYHKCQHCEKAFMNASFLQSHMQRRH-----P 231

  Fly   174 SLTSATGKEKDRDKATD-VHLINTIKMELEIKQLKERLNAAERNIKERSTGSKRVSPRQE----Q 233
            |       |.|....|| ...|.|:|::.||.:|:|:|...   ..:..|..|..:.:||    |
Zfish   232 S-------EFDMKLMTDNQKKIQTVKLQDEINKLQEQLTLV---TSQMETQQKDYTAKQEKELIQ 286

  Fly   234 RHVGIQSNLAEPKEKDEDSGEARQSEASER-KEQLTGLAERLSNFEEWQTQLKQSNEQFIQDINK 297
            |....:..|...||:::....::..|..:. :..:..:.:|..|.|....:|:|.|.|       
Zfish   287 RQEEFKRQLEIWKEEEKMRMNSKIDEVKQACQRDMDSMHQRNRNLETELLKLQQKNIQ------- 344

  Fly   298 RLEGLSHALEQSKQASASTPPLEDRV----------------ATPCLEDLERILTEKVAEIGKVS 346
              |.: .:::....||||....::.|                .....||.:|   ||.....::|
Zfish   345 --ESM-QSVQTQPNASASNEHWQEVVKLQQKLHKQEVKWTGKMQKMKEDHDR---EKSLSPTRLS 403

  Fly   347 AHR-LEEVVYHLEEGYKEKLGALERELKQLSVQKVQPEPVQTVPVASKIPKPVVRKEETNIDRIR 410
            .|| |:|.:..:.....|.:....|::::|| .::| |..|.:               |:.::..
Zfish   404 VHRQLQEELCKVSSAVSEGMEESRRQVQELS-HRLQ-EQQQII---------------TSQNKQM 451

  Fly   411 KQVESEFLKQKHDDDTYSIEEAPRKGSEKPFPQLVTQVQVVEKEQPSAGSSDSNPTYTKSPREPA 475
            ||:.|:       ..|.:::   |:|...|.|:  |:.:||..||       ||..:...|  ..
Zfish   452 KQISSK-------PPTITVQ---REGVSTPSPE--TKAKVVVSEQ-------SNSVHKLDP--IV 495

  Fly   476 PNKQETKEATDVSDSLSQEETENEEERSLTEEEG--TDVPTSGSEAAREDPTPKTIKPSGRIIKS 538
            ...:|.|:::.:|:|.::..:..:|.:.|.:..|  .|:..:......:......||....:.|:
Zfish   496 ELSEEDKDSSSISESPTENRSWQKEVQELLKNPGLRRDMRLAAQHNLDDRLQSLGIKGVSGLSKN 560

  Fly   539 PQK-PLTR--KDARKM-----VNRKLMSHGFDMKSKGISHNSLKRVNSELTEHRNKLKLQHPHFY 595
            ..| .:|:  .|.||.     |.|:.:        |.|||...:||....||...|.|| |....
Zfish   561 LYKSSMTQIISDRRKKLEEDPVYRRAL--------KEISHKLEQRVKERNTEQPVKPKL-HEQVV 616

  Fly   596 ATRNRIRKF---VEKLCSAKFSE---------RAEMLLKHK--SPLKPMEVPGKGIPRSAISEKS 646
            .:|.|...|   |.::.|...|:         |:...:.||  :||:....|    |.|     |
Zfish   617 QSRPRSSSFPSTVTRVMSGPASKQQRTPQPVPRSRSNVPHKTSTPLQHRRTP----PFS-----S 672

  Fly   647 EEDIASSQGEEQTDEQTDSSEQQTRSPSPQR---LVS-------RDFKARLEEILVKPAATIRGA 701
            :||  ||:.||:.:|:.:||:::  ||..|:   ||:       ...|.:.....|:||..:..|
Zfish   673 DED--SSEEEEEEEEEEESSDEE--SPQMQKKTVLVNSSTAKAQNTAKTQSTAQSVRPAVALTSA 733

  Fly   702 SKSSLS----------SRPVPLPRKRVMFNTTEDGKSFNDSDDNLK 737
            ..::::          |....:...::..:|.::|...|.:..|:|
Zfish   734 EPTNVTTLSDSDWSDGSEMEEINLSQLHKHTDQNGNLKNVTHSNVK 779

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13617NP_001262918.1 Dzip-like_N 16..133 CDD:290529 29/132 (22%)
dzip1XP_005165761.1 Dzip-like_N 65..185 CDD:290529 31/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IYV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I4996
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002370
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_135146
Panther 1 1.100 LDO PTHR21502
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5355
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.