DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13617 and Dzip1

Sequence 1:NP_001262918.1 Gene:CG13617 FlyBaseID:FBgn0039201 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_008769170.1 Gene:Dzip1 RGDID:1307701 Length:875 Species:Rattus norvegicus

Alignment Length:807 Identity:164/808 (20%)
Similarity:273/808 (34%) Gaps:224/808 (28%)


  Fly    24 GPL------------DWRLMGSYETERI--------LREQNF-----ELVDKALTHLSEAPLGTV 63
            |||            |||.:.:.:.:::        |:|...     :|.|:...|....     
  Rat    65 GPLPFFQFRPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSG----- 124

  Fly    64 LETHILDSGIAKYFVMSQYAIQYLMCCRTYLDECVTDLKEAHTTAQEEIATLRKSLSESNNEVVQ 128
                 :|..:.|...::|..|:|||..:.:|...:..::|          .||.||.:.......
  Rat   125 -----VDPVLLKLIRLAQLTIEYLMHSQEFLTSQLNLVEE----------RLRLSLMDYEQSKQL 174

  Fly   129 LHKRITQIEAIRE--------------------VVYPCHLCTKNFISNEALNVHIGRKHRVASPP 173
            |.|:..:|:.::|                    ..|.||||.|.|::...|..||.|:|      
  Rat   175 LTKQAGEIKLLKEECKRRKKMLSTQQLMIEAKASYYQCHLCDKAFMNQAFLQSHIQRRH------ 233

  Fly   174 SLTSATGKEKDRDKATDVHL-----INTIKMELEIKQLKERLNAAERNIKERSTGSKRVSPRQEQ 233
                          ..|.||     ..|.:::.||..|||:|......::.          .|..
  Rat   234 --------------TEDSHLEYNTKAQTDRLQKEIDMLKEQLQLTRTQLES----------AQHS 274

  Fly   234 RHVGIQSNLAEPKEKDEDSGEARQSEASERKEQLTGLAERLSNFEEWQTQLKQSNEQFIQDINKR 298
            ..|....:....|.|:||..:.......|.||:|         .||    :::..|.|:::. |:
  Rat   275 HAVRFSKDYEMQKIKEEDFLKLFDRWKEEEKEKL---------LEE----MEKVKEMFMREF-KK 325

  Fly   299 LEGLSHALEQSKQASASTPPLEDRVATPCLEDLERILTEKVAEIGKV-SAHRLEEVVYHLEEGYK 362
            |...:.|||..                  |.:::|...:..:.||.: .||.|.|......:.::
  Rat   326 LTSKNSALEYQ------------------LLEIQRSNIQIKSNIGTLRDAHELREDHLPYPQDFQ 372

  Fly   363 EKLGALERELKQLS--VQKVQPEPVQTVPVASKIPKPVVRKEE----TNIDRIRKQVESEFLKQK 421
            ..|..|:.:..:.|  .|.:..|.               .||:    ::|:::|    |..:|..
  Rat   373 NMLQLLDSQASKWSDRFQVLNEEH---------------SKEKGQLLSHIEKLR----SSMMKDL 418

  Fly   422 HDDDTY---SIEEAPRKGSEKPFPQLVTQVQVV----EKEQPSAGSSDSNP--TYTKSPREPAPN 477
            ..|:.:   .:||..:|..|:. ..::||.|.:    .|...|.......|  ..|..|:..|..
  Rat   419 SADNVFYKRRVEELGQKLQEQN-EVIITQKQQIREFASKPYHSVNEMKGTPLTRQTLEPKSAALT 482

  Fly   478 KQETKEATDVSDSLSQ-----------------EETENEEERSLTEEEGTDVPTSGSEAAREDPT 525
            ......||...|..|.                 .|..:|||:....|:.|:..|...:....:||
  Rat   483 TPMNASATQNLDGTSNLTMVHEQVFSSHILEPIAELSSEEEKGRENEQKTNKKTHVRKTPNTNPT 547

  Fly   526 PKTIKPSGRIIKSPQKPLTRKDARKMVNRKLMSHGFDMKSKGISHNSLKRVNSELTEHRNKLKLQ 590
            ||.:               |.:..|.:..||.|.|.....:||....|.|....:...|:.|..|
  Rat   548 PKEL---------------RTNLEKELGNKLRSFGISENIQGIPCEILNRSLKAMQVARHDLAKQ 597

  Fly   591 HPHFYATRNRIRKFVEKLCSAKFSERAEML--LKHKSPL---KPMEVPGKGI---PRSAISEKSE 647
            .|..    .:||:.:|.....|..|||...  .:|..|:   .|.||| |..   |||....:.:
  Rat   598 VPDI----QQIRENLEHQLICKMGERASHSSDRRHAPPMASFPPEEVP-KATQLPPRSRPLVRQK 657

  Fly   648 EDIASSQGEEQTDEQTDSSEQQTRSPSPQRLVSRDFKARLEEILVKPAATIRGASKSSLSSRPVP 712
            ..........:..:.|..|....|.|:.:.......:...||..::     ...|...|.::|..
  Rat   658 TMFTDKASAPKLKKNTKESHFLRRFPATKTPPFSSEEEPEEEGFMR-----AHRSPDVLPTQPPK 717

  Fly   713 LPR----KRVMFNTTE--DGKSFNDSD 733
            ..|    :|.:.:.|:  :|...:|||
  Rat   718 NKRSNFGRRAVRSDTDWTEGSEMDDSD 744

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13617NP_001262918.1 Dzip-like_N 16..133 CDD:290529 26/134 (19%)
Dzip1XP_008769170.1 Dzip-like_N 70..190 CDD:290529 25/140 (18%)
C2H2 Zn finger 212..233 CDD:275368 10/21 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IYV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5210
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002370
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_135146
Panther 1 1.100 LDO PTHR21502
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.910

Return to query results.
Submit another query.