DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13617 and Dzip1l

Sequence 1:NP_001262918.1 Gene:CG13617 FlyBaseID:FBgn0039201 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_008764748.1 Gene:Dzip1l RGDID:1311430 Length:803 Species:Rattus norvegicus

Alignment Length:855 Identity:160/856 (19%)
Similarity:303/856 (35%) Gaps:276/856 (32%)


  Fly    16 FKLRQYRDGPLDWRLMGSYETERILREQNFELVDKALTHLSEAPLGTVLETHI---LDSGIAKYF 77
            ||.:..|:. :|||.:.:.:.:|:.||.:...:.:.:..::...|...:..|.   :|..:.|..
  Rat    50 FKFQPRRES-IDWRRISAVDVDRVARELDVATLQENIAGVTFCNLDREVCNHCRQPVDPVLLKVL 113

  Fly    78 VMSQYAIQYLMCCRTYLDECVTDLKEAHTTAQEEIATLRKSLSESNNEVVQLHKRITQIEAIRE- 141
            .::|..|:||:.|:..|...|..|:          |.|:.||.:......:|.::..:::.:|| 
  Rat   114 RLAQLIIEYLLHCQDCLSASVAQLE----------ARLQASLGQQQRGQQELGRQADELKGVREE 168

  Fly   142 ---------------------VVYPCHLCTKNFISNEALNVHIGRKHRVASPPSLTSATGKEKDR 185
                                 ..:.||||.|.|::...|..||.|:|      :..:..||:|..
  Rat   169 SRRRRKMISTLQQLLLQTGAHSYHTCHLCDKTFMNATFLRGHIQRRH------AGMAEVGKQKQE 227

  Fly   186 DKATDV--HLINTIKM---ELEIKQLKERLNAAE--RNIKERSTGSKRVSPRQEQRH-------- 235
            .:..:|  .|...:|.   |||.::..||...|:  ..|::|...:|:.....:::.        
  Rat   228 QQLGEVLEELRAKLKWTQGELEAQREAERQRQAQELEMIRQREIEAKKKFDEWKEKERSKLYGEI 292

  Fly   236 -------------VGIQSNLAEPKEK--------DEDSGEARQSEASER---KEQLTGLAERLS- 275
                         |..|::..|.|.|        :...|..|..|:.||   .::|..|.|::. 
  Rat   293 DKLKQLFWDEFKTVANQNSTLEEKLKVLQSYSMTESHLGSLRDEESEERLKHAQELQALREKMDI 357

  Fly   276 NFEEWQTQLKQSNEQ------FIQDINKRLEGLSHALEQSKQASASTPPLEDRVATPCLEDLERI 334
            ...||:.::|..:|:      .:|:.|:||. ::.:.:|.|.|:.|...:....|.  |::..|:
  Rat   358 QKTEWKRKMKALHEERAAERRQLQEENERLH-VTLSQDQKKAAAQSQRHINALRAQ--LQEQARL 419

  Fly   335 LTEKVAEIGKVSAHRLEEVVYHLEEGYKEKLGALERELKQLSVQKVQPEPVQTVPVASKIPKPVV 399
            :..:...|..:|..|:|||                                      .::||.||
  Rat   420 IESQEETIQTLSFRRMEEV--------------------------------------QEVPKAVV 446

  Fly   400 RKEETNIDRIRKQVESE---------------FLKQKHD--DDTYSIEE-----APRKGSEKPFP 442
            .:|:::.:.:...:|.:               :|||...  :||  :||     ..::|::....
  Rat   447 TEEDSSEEELEASLEEQQEQRKVLAALRNNPAWLKQFRPILEDT--LEEKLEGMGIKRGTKGISA 509

  Fly   443 QLVTQVQVVEKEQPSAGSSDSNPTYTKSPREPAPNKQETKEATDVSDSLSQEETENEEERSLTEE 507
            |.|.::                        ||....|..:.|....:.||..|..|:|..|..::
  Rat   510 QTVRRL------------------------EPLLRTQREQTARSFREFLSLREKLNQEVSSRAKK 550

  Fly   508 --EGT----------DVPTSGSEAAREDPTPKTIKPSGRIIKSPQKPLTRKDARKMVNRKLMSHG 560
              |||          .|.:..:..|..:..|||...:..:...|.:|.|      ...|...|||
  Rat   551 RWEGTAVVPQPDGQPPVKSQRTTLATREVRPKTRTLTVALPSKPAEPST------STPRGHSSHG 609

  Fly   561 FDMKSKGISHNSLKRVNSELTEHRNKLKLQHPHFYATRNRIRKFVEKLCSAKFSERAEMLLKHKS 625
                      ..|.:|::.:                .|.|:                     |..
  Rat   610 ----------PGLTQVSTPI----------------PRPRV---------------------HGP 627

  Fly   626 PLKPMEVPGKGI---PRSAISEKSEEDI--------------ASSQGEEQ---TDEQTDSSEQQT 670
            ...|:. ||.|:   |..:..|:.|.|:              ::.|.|:.   :|.:|  ||:..
  Rat   628 SSTPVS-PGPGLSSTPPFSSEEEPEGDVVQRVSLQPPKVLPRSAPQPEDNWGWSDSET--SEESA 689

  Fly   671 RSP--------SPQRLVS---RDFKARLEEILVKPAATIRGASKSSLSSRPVPLPRKRVMFNTTE 724
            :||        |...||.   ::.:.:||....||:..:....:.:.:.:....|.::...:..|
  Rat   690 QSPGKGSDGLASSATLVQSMVKNLEKQLETPAKKPSGGVNMFLRPNTALQRSSTPARKTQLSEDE 754

  Fly   725 DGKSFNDSDD 734
            .....:..:|
  Rat   755 SDLEISSLED 764

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13617NP_001262918.1 Dzip-like_N 16..133 CDD:290529 26/120 (22%)
Dzip1lXP_008764748.1 Dzip-like_N 50..170 CDD:290529 28/131 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IYV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5210
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002370
OrthoInspector 1 1.000 T1087455
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21502
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
77.020

Return to query results.
Submit another query.