DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13617 and Rilpl

DIOPT Version :9

Sequence 1:NP_001262918.1 Gene:CG13617 / 42921 FlyBaseID:FBgn0039201 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001259133.1 Gene:Rilpl / 31090 FlyBaseID:FBgn0024985 Length:486 Species:Drosophila melanogaster


Alignment Length:443 Identity:90/443 - (20%)
Similarity:169/443 - (38%) Gaps:114/443 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LTSATGKEKDR--DK-ATDV------HLINTIKMELEIKQLKERLNAAERNIKERSTGSKRVSPR 230
            |.|..|||.:|  |: .||.      .:|||:::...:....||.||..:.:::           
  Fly    28 LASDIGKEYERIMDRFGTDAVSGLMPKIINTLELLEALATKNERENATIQELRD----------- 81

  Fly   231 QEQRHVGIQSNLAEPKEKDEDSGEARQSEASERKEQLTGLAERLSNFEEWQTQLKQSNE-----Q 290
                           |....:|.:..::|...|.::...|.|     |:|::   ::||     .
  Fly    82 ---------------KVAQLESEKLEKAEFRRRFDKELELIE-----EQWRS---ETNELVDLVS 123

  Fly   291 FIQDINKRLEGLSHALEQSK-QASASTPPLEDRVATPCLEDLERILTEKVAEIGKVSAHRLEEVV 354
            .:||.||||...:..|:.|. |:|.....|.:.:.:....:|...|::...      ..||:|.:
  Fly   124 SLQDENKRLVKQTQDLQSSSAQSSGLGASLTESIISMTNHELHSALSDTQV------LQRLKEQI 182

  Fly   355 YHLEEGYKEKLGALE---RELKQLSVQ---------------KVQPEPVQTVPVASKIPKPVVRK 401
            |...:..|.:...|:   .||:.|::|               |:....|:|:..........::.
  Fly   183 YKQRDELKHRERELQDKYSELEHLNIQAERLKASERDTRRRHKLMQAQVKTLCEERADFLAQLQD 247

  Fly   402 EETNIDRIRKQV-----ESEFLKQKHDD-------DTYSIEEAPRKGSEKPFPQLVTQVQVVEKE 454
            :...|:::||::     |:|.|...:||       ..|:..|.....||:  .:|:|.:..:.::
  Fly   248 QSREINQLRKRLGLAEKENEDLVASYDDGQNDPNRPRYTTRELKELISER--DELLTTIDTLNEQ 310

  Fly   455 QPSAGSSDSNPTYTKSPREPAPNKQETKEATDVSDS-----LSQEETENEEERSLTEEEGTDVPT 514
            ...          .|.|.:....:|....::|.||.     ::..:.:::||.:..|....:.|.
  Fly   311 LAE----------LKPPSQAKGKRQRHFSSSDDSDEDDDGHVADNDDDDDEEEAAAEANELEPPA 365

  Fly   515 SGS-----EAAREDPTPKTIKPSGRIIKSPQKPLTRKDARKMVNRKLMSHGFD 562
            :|.     :|..:.|.|  .:|.    .:|.|..:....||.. |||.|...|
  Fly   366 AGETPPGHDAPVQGPLP--YEPD----DAPWKKSSESGIRKFF-RKLFSDPSD 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13617NP_001262918.1 Dzip-like_N 16..133 CDD:290529
RilplNP_001259133.1 Jnk-SapK_ap_N 26..186 CDD:286787 43/197 (22%)
KASH_CCD 114..314 CDD:291334 42/217 (19%)
Med30 <239..315 CDD:288208 14/87 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21502
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.