DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13617 and DZIP1

Sequence 1:NP_001262918.1 Gene:CG13617 FlyBaseID:FBgn0039201 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_006719979.1 Gene:DZIP1 HGNCID:20908 Length:932 Species:Homo sapiens

Alignment Length:805 Identity:170/806 (21%)
Similarity:290/806 (36%) Gaps:211/806 (26%)


  Fly    24 GPL------------DWRLMGSYETERI--------LREQNF-----ELVDKALTHLSEAPLGTV 63
            |||            |||.:.:.:.:::        |:|...     :|.|:...|....     
Human    99 GPLPFFQFRPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSG----- 158

  Fly    64 LETHILDSGIAKYFVMSQYAIQYLMCCRTYLDECVTDLKE----AHTTAQEEIATLRKSLSE--S 122
                 :|..:.|...::|:.|:||:..:.:|...:..|:|    :|...::....|.|...|  :
Human   159 -----VDPVLLKLIRLAQFTIEYLLHSQEFLTSQLHTLEERLRLSHCDGEQSKKLLTKQAGEIKT 218

  Fly   123 NNEVVQLHKRI--TQ---IEAIREVVYPCHLCTKNFISNEALNVHIGRKHRVASPPSLTSATGKE 182
            ..|..:..|::  ||   ||| :...|.||.|.|.|::...|..||.|:|         :.....
Human   219 LKEECKRRKKMISTQQLMIEA-KANYYQCHFCDKAFMNQAFLQSHIQRRH---------TEENSH 273

  Fly   183 KDRDKATDVHLINTIKMELEIKQLKERLNAAERNIKERSTGSK-RVSPRQEQRHVGIQSNLAEPK 246
            .:..|...:.     |:..||..|||.|......::.....|. |.|...|.:           |
Human   274 FEYQKNAQIE-----KLRSEIVVLKEELQLTRSELEAAHHASAVRFSKEYEMQ-----------K 322

  Fly   247 EKDEDSGEARQSEASERKEQLTGLAERLSNFEEWQTQLKQSNEQFIQDINKRLEGLSHALE-QSK 310
            .|:||..:.......|.||:|.             .::::..|.|:::. |.|...:.||| |..
Human   323 TKEEDFLKLFDRWKEEEKEKLV-------------DEMEKVKEMFMKEF-KELTSKNSALEYQLS 373

  Fly   311 QASASTPPLEDRVAT------------PCLEDLERILTEKVAEIGKVSAHRLEEVVYHLEEGYKE 363
            :...|...::..:.|            |..:|...::....::..|.:|.     |..:.:.:|:
Human   374 EIQKSNMQIKSNIGTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWTAR-----VQAIHQEHKK 433

  Fly   364 KLGALERELKQLSVQKVQPEPVQTVPVASKIPKPVVRKEETN--IDRIRKQVESEFLKQKHDDDT 426
            :.|.|...:::|....:.......|....:|.:...|.:|.|  |...|:|::         |.|
Human   434 EKGRLLSHIEKLRTSMIDDLNASNVFYKKRIEELGQRLQEQNELIITQRQQIK---------DFT 489

  Fly   427 YSIEEAPRKGSEKPFPQLVTQVQVVEKEQPSAGSS-DSNPTYTKSP-REPAPNKQETKEA----- 484
            .:    |.....:|            |..|.|..: :|.|.....| ..||.:..|||.:     
Human   490 CN----PLNSISEP------------KGNPLAWQAFESQPAAPAVPMNAPALHTLETKSSLPMVH 538

  Fly   485 --------TDVSDSLSQEETENEEERSLTEEEGTDVPTSGSEAAREDPTPKTIKPSGRIIKSPQK 541
                    .:..:.||:||...|.|:.|..              .:....|.:|.:..:.|.   
Human   539 EQAFSSHILEPIEELSEEEKGRENEQKLNN--------------NKMHLRKALKSNSSLTKG--- 586

  Fly   542 PLTRKDARKMVNRKLMSH----GFDMKSKGISHNSLKRVNSELTEHRNKLKLQHPHFYATRNRIR 602
                  .|.||.:.||..    |.:...:|||.:.|.||...:...|:|.:.:.|:|:    :||
Human   587 ------LRTMVEQNLMEKLETLGINADIRGISSDQLHRVLKSVESERHKQEREIPNFH----QIR 641

  Fly   603 KFVEKLCSAKFSERAEMLLKHKSPLKPMEVPGKG-IPRSAISEKSEEDIASSQGEEQTDEQTDSS 666
            :|:|...|.|..|:| :|...:..:..|:....| :|:.         |.......|...|...|
Human   642 EFLEHQVSCKIEEKA-LLSSDQCSVSQMDTLSTGEVPKM---------IQLPSKNRQLIRQKAVS 696

  Fly   667 EQQTRSPSPQRLVSRD-FKARLEEILVKPAAT---------IRG-ASKSSLSSRPVPLPRKRVMF 720
            ..:|..|..::.|..| |..:...|...|.::         ||. ||...|   |||.|:.:..|
Human   697 TDRTSVPKIKKNVMEDPFPRKSSTITTPPFSSEEEQEDDDLIRAYASPGPL---PVPPPQNKGSF 758

  Fly   721 --NTTE------DGKSFNDSDDNLK 737
              ||.:      :|....|:||:.|
Human   759 GKNTVKSDADGTEGSEIEDTDDSPK 783

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13617NP_001262918.1 Dzip-like_N 16..133 CDD:290529 26/140 (19%)
DZIP1XP_006719979.1 Dzip-like_N 104..224 CDD:290529 22/130 (17%)
C2H2 Zn finger 246..267 CDD:275368 9/21 (43%)
iSH2_PI3K_IA_R 273..402 CDD:304922 31/159 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IYV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5243
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002370
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_135146
Panther 1 1.100 LDO PTHR21502
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5355
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.