DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13617 and DZIP1L

Sequence 1:NP_001262918.1 Gene:CG13617 FlyBaseID:FBgn0039201 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_011510820.1 Gene:DZIP1L HGNCID:26551 Length:806 Species:Homo sapiens

Alignment Length:740 Identity:158/741 (21%)
Similarity:283/741 (38%) Gaps:210/741 (28%)


  Fly    16 FKLRQYRDGPLDWRLMGSYETERILREQNFELVDKALTHLSEAPLGTVLETHI---LDSGIAKYF 77
            ||. |.|...:|||.:.:.:.:|:.||.:...:.:.:..::...|...:.:..   :|..:.|..
Human    52 FKF-QPRHDSMDWRRISTLDVDRVARELDVATLQENIAGITFCNLDREVCSRCGQPVDPALLKVL 115

  Fly    78 VMSQYAIQYLMCCRTYLDECVTDLKEAHTTAQEEIATLRKSLSESNNEVVQLHKRITQIEAIRE- 141
            .::|..|:||:.|:..|...|..|:          |.|:.||.:......:|.::..:::.:|| 
Human   116 RLAQLIIEYLLHCQDCLSASVAQLE----------ARLQTSLGQQQRGQQELGRQADELKGVREE 170

  Fly   142 ---------------------VVYPCHLCTKNFISNEALNVHIGRKHRVASPPSLTSATGKEKDR 185
                                 ..:.||||.|.|::...|..||.|:|      :..:..||:|  
Human   171 SRRRRKMISTLQQLLMQTGTHSYHTCHLCDKTFMNATFLRGHIQRRH------AGVAEGGKQK-- 227

  Fly   186 DKATDVHLINTIKMELEIKQLKERLNAAERNIKERSTGSKRVSPRQEQRHVGIQSNLAEPKEKDE 250
                        |.|..::::.|.|.|     |.:.|..:..:.|:.:|    |..|.|.:...:
Human   228 ------------KQEQPVEEVLEELRA-----KLKWTQGELEAQREAER----QRQLQEAELIHQ 271

  Fly   251 DSGEARQSEASERKEQ----LTGLAERLSN--FEEWQTQLKQSNEQFIQDINKRLEGL-SHALEQ 308
            ...||:: |..:.|||    |.|..::|..  ::|::...||::     .:.::|..| ||::.:
Human   272 REIEAKK-EFDKWKEQEWTKLYGEIDKLKKLFWDEFKNVAKQNS-----TLEEKLRALQSHSVME 330

  Fly   309 SKQASASTPPLEDRVATPCLEDLERI--LTEKVAEIGKVSAHRLEEVVYHLEEGYKEKLGALERE 371
            ||..|     |.|..:...|.....:  |.|| .||.|....|..:.::  ||...||     :|
Human   331 SKLGS-----LRDEESEEWLRQARELQALREK-TEIQKTEWKRKVKELH--EEHMAEK-----KE 382

  Fly   372 LKQLSVQKVQPEPVQTVPVASKIPKPVVRKEETNIDRIRKQVESEFLKQKHDDDTYSIEEAPRKG 436
            |::.: |::|..       .|:..|....:.:..|..:|.|::               |:|....
Human   383 LQEEN-QRLQAS-------LSQDQKKAAAQSQCQISTLRAQLQ---------------EQARIIA 424

  Fly   437 SEKPFPQLVT--QVQVVEKEQPSAGSSDSNPTYTKSPREPAPNKQETKEATDVSDSLSQEETENE 499
            |::...|.::  :|:.:.| .|.|..::.:     ||.|                  ..|::::|
Human   425 SQEEMIQSLSLRKVEGIHK-VPKAVDTEED-----SPEE------------------EMEDSQDE 465

  Fly   500 EERSLTEEEGTDVPTSGSEAAREDPT-PKTIKPSGRIIKSPQKPLTRKDARKMVNRKLMSHGFDM 563
            :.:.|.             |.|.:|| .|..:|   |::.            .:..||.|.|...
Human   466 QHKVLA-------------ALRRNPTLLKHFRP---ILED------------TLEEKLESMGIRK 502

  Fly   564 KSKGISHNSLKRVNSELTEHRNKLKLQHPHFYATRNRIRKFVEKLCSAKFSERAEMLLKHKSPLK 628
            .:||||..:|:.:.|.|...|.:             :.|||.|.|     |.|.:::.:..|..|
Human   503 DAKGISIQTLRHLESLLRVQREQ-------------KARKFSEFL-----SLRGKLVKEVTSRAK 549

  Fly   629 PMEVPGKGIPRSAISEKSEEDIASSQGEEQTDEQTDSSEQQTRSPSPQRLVSRDFKARLEEILVK 693
                           |:.|.....||.:.|...::..|...||...|:   :|..:..|.....:
Human   550 ---------------ERQENGAVVSQPDGQPSVKSQQSTLVTREAQPK---TRTLQVALPSTPAE 596

  Fly   694 PAATIR---GASKSSLSSRPVPLPR 715
            |....|   |:..|||:....|.||
Human   597 PPPPTRQSHGSHGSSLTQVSAPAPR 621

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13617NP_001262918.1 Dzip-like_N 16..133 CDD:290529 26/120 (22%)
DZIP1LXP_011510820.1 Dzip-like_N 52..172 CDD:290529 28/131 (21%)
DUF4795 233..403 CDD:292662 49/206 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IYV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5243
Isobase 1 0.950 0 Normalized mean entropy S8157
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002370
OrthoInspector 1 1.000 T1073823
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21502
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5355
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.