DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13617 and C01G5.7

Sequence 1:NP_001262918.1 Gene:CG13617 FlyBaseID:FBgn0039201 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001293705.1 Gene:C01G5.7 WormBaseID:WBGene00015309 Length:156 Species:Caenorhabditis elegans

Alignment Length:129 Identity:26/130 (20%)
Similarity:53/130 (41%) Gaps:8/130 (6%)


  Fly    44 NFELVDKALTHLSEAPLGTVLETHILDSGIAKYFVMSQYAIQYLMCCRTYLDECVTDLKEAHTTA 108
            |:.|:|:....|.|..:||:   .:|.:.:.....:||...:.....|..|......::....:.
 Worm    21 NWALLDEISVPLLETGVGTL---PLLQAALPSILSISQNDDKVKERYRKVLRIAQLQIEHLLKSQ 82

  Fly   109 QEEIATLRKSLSESNNEV-----VQLHKRITQIEAIREVVYPCHLCTKNFISNEALNVHIGRKH 167
            ||.:..:.|..||:.:.:     :::.::.:.........|.|..|.|.|::...|..|..|:|
 Worm    83 QELLKHMEKLESENISRILKPKNMKMERKTSGGSPENNDKYKCADCGKIFLNENFLTSHFERRH 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13617NP_001262918.1 Dzip-like_N 16..133 CDD:290529 17/94 (18%)
C01G5.7NP_001293705.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002370
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.