DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13616 and CG17780

DIOPT Version :10

Sequence 1:NP_651262.1 Gene:CG13616 / 42917 FlyBaseID:FBgn0039200 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster


Alignment Length:238 Identity:48/238 - (20%)
Similarity:85/238 - (35%) Gaps:100/238 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HFSLLALCLLLH-------------------------------EVQSQVMSMSSA-------ANR 34
            |.|.||| |:||                               ...|.::|.|::       .:.
  Fly     3 HLSALAL-LMLHLLLVVPIPASNPPVTQPQPVDNFEGLSPLSKHFDSHMVSPSTSNIPSSDFDSA 66

  Fly    35 TGEVTKVLRRHKRYLAFPEGSSVSGAVCMTIGMIGNPDVDYLSWAVNWGVAYDLPNHQWVIQ--- 96
            :|..|::|||.||||.|.:||.                   :||..|.      .|:.|.|.   
  Fly    67 SGNSTRILRRGKRYLQFSKGSR-------------------MSWRTNG------KNNLWTINTLY 106

  Fly    97 -HAHGLNATLAKDTIK----------RRSRRAFYDEVQSLFDNMGFNGRSCVARALCESAKFMLP 150
             :.:|..|.....:|:          |..:|..:.::::..|..||:||:|:.::.|.:...:..
  Fly   107 AYGYGFRANYPFPSIEEQKKDNAVFFRLFKRDLFSKLETALDGHGFDGRACMLKSFCTAINDVDN 171

  Fly   151 SVERGNMLQELVRTVFSLPPSPVAAHEPQAHHQYDRIYRRSKR 193
            ..::..||.::::.:|                      ||:||
  Fly   172 PKQKSGMLFKMLKLIF----------------------RRAKR 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13616NP_651262.1 DM4_12 110..212 CDD:214785 17/94 (18%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:462285 11/73 (15%)
DM4_12 253..338 CDD:214785
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.